CLN6 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLN6 Source: E. coli
Amino Acid Sequence: VGDSVNHRLLFSGYQHHLSVRENPIIKNLKPETLIDSFELLYYYDEYL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
CLN6 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17819. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for CLN6 Recombinant Protein Antigen
Background
CLN6, a 311-amino acid protein, has 7 predicted transmembrane domains and is conserved across vertebrates. The CLN6 protein localizes to the endoplasmic reticulum but contributes to lysosomal function. Mutations in the CLN6 gene cause variant late-onset infantile neuronal ceroid lipofuscinosis (vLINCL), a lysosomal storage disorder marked by progressive mental deterioration and blindness; part of a group of severe inherited neurodegenerative disorders affecting children wherein lysosomes accumulate storage material, causing the death of neurons. CLN6 is one of eight proteins, including CLN1-8, that are associated with NCL.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pl, Rt
Applications: ChIP, ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IM, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ICC, IHC, IP, WB
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: DirELISA, IHC, WB
Species: Ca, ChHa, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for CLN6 Recombinant Protein Antigen (NBP3-17819PEP) (0)
There are no publications for CLN6 Recombinant Protein Antigen (NBP3-17819PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CLN6 Recombinant Protein Antigen (NBP3-17819PEP) (0)
There are no reviews for CLN6 Recombinant Protein Antigen (NBP3-17819PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for CLN6 Recombinant Protein Antigen (NBP3-17819PEP) (0)
Additional CLN6 Products
Blogs on CLN6