CLN6 Recombinant Protein Antigen

Images

 
There are currently no images for CLN6 Protein (NBP2-39066PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CLN6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLN6.

Source: E.coli

Amino Acid Sequence: WNDPVLRKKYPGVIYVPEPWAFYTLHVSSR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLN6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-39066.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CLN6 Recombinant Protein Antigen

  • ceroid-lipofuscinosis neuronal protein 6
  • ceroid-lipofuscinosis, neuronal 6, late infantile, variant
  • FLJ20561
  • HsT18960
  • nclf
  • Protein CLN6

Background

CLN6, a 311-amino acid protein, has 7 predicted transmembrane domains and is conserved across vertebrates. The CLN6 protein localizes to the endoplasmic reticulum but contributes to lysosomal function. Mutations in the CLN6 gene cause variant late-onset infantile neuronal ceroid lipofuscinosis (vLINCL), a lysosomal storage disorder marked by progressive mental deterioration and blindness; part of a group of severe inherited neurodegenerative disorders affecting children wherein lysosomes accumulate storage material, causing the death of neurons. CLN6 is one of eight proteins, including CLN1-8, that are associated with NCL.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48820
Species: Hu
Applications: IHC, IHC-P
NBP1-85563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-87974
Species: Hu
Applications: IHC, IHC-P, WB
NB600-241
Species: Hu, Mu, Pl, Rt
Applications: ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IM, KD, Simple Western, WB
NBP2-43782
Species: Hu
Applications: WB
NBP2-92342
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-92707
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-92114
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
H00065057-M02
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-14870
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, WB
NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-86687
Species: Hu
Applications: IHC, IHC-P, WB
MAB3446
Species: Hu
Applications: WB
PP-H7223-00
Species: Hu
Applications: DirELISA, IHC, WB
NB100-448
Species: Ca, ChHa, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-39066PEP
Species: Hu
Applications: AC

Publications for CLN6 Protein (NBP2-39066PEP) (0)

There are no publications for CLN6 Protein (NBP2-39066PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLN6 Protein (NBP2-39066PEP) (0)

There are no reviews for CLN6 Protein (NBP2-39066PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CLN6 Protein (NBP2-39066PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLN6 Products

Bioinformatics Tool for CLN6 Protein (NBP2-39066PEP)

Discover related pathways, diseases and genes to CLN6 Protein (NBP2-39066PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLN6 Protein (NBP2-39066PEP)

Discover more about diseases related to CLN6 Protein (NBP2-39066PEP).
 

Pathways for CLN6 Protein (NBP2-39066PEP)

View related products by pathway.

PTMs for CLN6 Protein (NBP2-39066PEP)

Learn more about PTMs related to CLN6 Protein (NBP2-39066PEP).

Blogs on CLN6

There are no specific blogs for CLN6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CLN6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CLN6