CLK3 Antibody - BSA Free

Western Blot: CLK3 Antibody [NBP1-91794] - Analysis in human cell line Jurkat.

Immunocytochemistry/Immunofluorescence: CLK3 Antibody [NBP1-91794] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CLK3 Antibody [NBP1-91794] - Staining of human liver shows very weak positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: CLK3 Antibody [NBP1-91794] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts and Leydig cells.

Immunohistochemistry-Paraffin: CLK3 Antibody [NBP1-91794] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: CLK3 Antibody [NBP1-91794] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CLK3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKE
• Predicted Species: Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLK3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CLK3 Protein (NBP1-91794PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CLK3 Antibody - BSA Free

• CDC-like kinase 3
• CDC-like kinase 3PHCLK3
• CLK3
• dual specificity protein kinase CLK3
• EC 2.7.12.1
• FLJ22858
• PHCLK3/152

Background

The CLK3 gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (SR) family of splicing factors. Alternati

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLK3