CLCN6 Antibody

Images

 
Western Blot: CLCN6 Antibody [NBP2-84691] - Host: Rabbit. Target Name: CLCN6. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLCN6 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLCN6. Peptide sequence: RYTPYPNLYPDQSPSEDWTMEERFRPLTFHGLILRSQLVTLLVRGVCYSE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CLCN6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLCN6 Antibody

  • chloride channel 6
  • Chloride channel protein 6
  • chloride transport protein 6
  • ClC-6
  • KIAA0046CLC-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91791
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5447
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP1-89926
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-59379
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-69123
Species: Mu, Rt
Applications: WB
H00001181-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP1-84452
Species: Hu
Applications: IHC, IHC-P
MAB25031
Species: Hu
Applications: IHC, IP, WB
H00001180-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-46201
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87974
Species: Hu
Applications: IHC, IHC-P, WB
NB600-241
Species: Hu, Mu, Pl, Rt
Applications: ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IM, KD, Simple Western, WB
NBP1-81829
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-92433
Species: Hu, Mu
Applications: WB
NBP2-37607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
H00001188-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB400-129
Species: Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-84691
Species: Hu
Applications: WB

Publications for CLCN6 Antibody (NBP2-84691) (0)

There are no publications for CLCN6 Antibody (NBP2-84691).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLCN6 Antibody (NBP2-84691) (0)

There are no reviews for CLCN6 Antibody (NBP2-84691). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLCN6 Antibody (NBP2-84691) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLCN6 Products

Array NBP2-84691

Bioinformatics Tool for CLCN6 Antibody (NBP2-84691)

Discover related pathways, diseases and genes to CLCN6 Antibody (NBP2-84691). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLCN6 Antibody (NBP2-84691)

Discover more about diseases related to CLCN6 Antibody (NBP2-84691).
 

Pathways for CLCN6 Antibody (NBP2-84691)

View related products by pathway.

PTMs for CLCN6 Antibody (NBP2-84691)

Learn more about PTMs related to CLCN6 Antibody (NBP2-84691).
 

Research Areas for CLCN6 Antibody (NBP2-84691)

Find related products by research area.

Blogs on CLCN6

There are no specific blogs for CLCN6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLCN6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLCN6