CLCN4 Recombinant Protein Antigen

Images

 
There are currently no images for CLCN4 Protein (NBP1-84452PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CLCN4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLCN4.

Source: E. coli

Amino Acid Sequence: VVSRDSERLIGFAQRRELILAIKNARQRQEGIVSNSIMYFTEEPPELPANSPHPLKLRRILNLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLCN4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84452.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CLCN4 Recombinant Protein Antigen

  • chloride channel 4
  • Chloride channel protein 4
  • Chloride transporter ClC-4
  • CLC4
  • ClC-4
  • ClC-4A
  • H(+)/Cl(-) exchange transporter 4
  • MGC163150

Background

The family of voltage-dependent chloride channels (CLCs) regulate cellular trafficking of chloride ions, a critical component of all living cells. CLCs regulate excitability in muscle and nerve cells, aid in organic solute transport and maintain cellular volume. The genes encoding human CLC-1 through CLC-7 map to chromosomes 7, 3q26, 4q32, Xp22, Xp11, 1p36 and 16p13, respectively. CLC-1 is highly expressed in skeletal muscle. Mutations in the gene encoding CLC-1 lead to myotonia, an inheritable disorder characterized by muscle stiffness and renal salt wasting. CLC-2 is highly expressed in the epithelia of several organs including lung, which suggests CLC-2 may be a possible therapeutic target for cystic fibrosis. CLC-3 expression is particularly abundant in neuronal tissue, while CLC-4 expression is evident in skeletal and cardiac muscle as well as brain. Mutations in the gene encoding CLC-5 lead to Dent's disease, a renal disorder characterized by proteinuria and hypercalciuria. CLC-6 and CLC-7 are broadly expressed in several tissues including testes, kidney, brain and muscle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69123
Species: Mu, Rt
Applications: WB
NBP1-91790
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF5447
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
MAB962
Species: Hu
Applications: IHC, WB
H00001181-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP2-92800
Species: Hu, Mu, Rt
Applications: ELISA, WB
H00001185-M05
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-92461
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-10348
Species: Hu
Applications: WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-46201
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-80973
Species: Hu
Applications: IHC,  IHC-P, KD, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-236
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, WB
NBP2-15437
Species: Hu, Pm, Mu
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP1-84452PEP
Species: Hu
Applications: AC

Publications for CLCN4 Protein (NBP1-84452PEP) (0)

There are no publications for CLCN4 Protein (NBP1-84452PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLCN4 Protein (NBP1-84452PEP) (0)

There are no reviews for CLCN4 Protein (NBP1-84452PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CLCN4 Protein (NBP1-84452PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLCN4 Products

Research Areas for CLCN4 Protein (NBP1-84452PEP)

Find related products by research area.

Blogs on CLCN4

There are no specific blogs for CLCN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CLCN4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CLCN4