Novus Biologicals products are now on bio-techne.com

Recombinant Human CLCN3 GST (N-Term) Protein

Images

 
Recombinant Human CLCN3 Protein [H00001182-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human CLCN3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-99 of Human CLCN3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTHLLDLLDEPIPGVGTYDDFHTIDWVREKCK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CLCN3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00001182-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CLCN3 GST (N-Term) Protein

  • chloride channel 3
  • Chloride channel protein 3
  • Chloride transporter ClC-3
  • CLC3
  • ClC-3
  • H(+)/Cl(-) exchange transporter 3

Background

CLCN3 mediates the exchange of chloride ions against protons. Functions as antiporter and contributes to theacidification of the endosome and synaptic vesicle lumen, and may thereby affect vesicle trafficking and exocytosis.May play an important role in n

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001181-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP1-69123
Species: Mu, Rt
Applications: WB
NBP1-84452
Species: Hu
Applications: IHC, IHC-P
NBP1-91791
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46201
Species: Hu
Applications: IHC, IHC-P, WB
AF5447
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP1-89926
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00001185-M05
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-92461
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
NBP2-33958
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80070
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-33694
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001188-P01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
DY413
Species: Mu
Applications: ELISA

Publications for CLCN3 Partial Recombinant Protein (H00001182-Q01)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for CLCN3 Partial Recombinant Protein (H00001182-Q01) (0)

There are no reviews for CLCN3 Partial Recombinant Protein (H00001182-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLCN3 Partial Recombinant Protein (H00001182-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLCN3 Products

Array H00001182-Q01

Research Areas for CLCN3 Partial Recombinant Protein (H00001182-Q01)

Find related products by research area.

Blogs on CLCN3

There are no specific blogs for CLCN3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CLCN3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLCN3