CLC Antibody - Azide and BSA Free Summary
| Immunogen |
CLCF1 (NP_037378.1, 1 a.a. - 225 a.a.) full-length human protein. MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
CLCF1 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot, Functional |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CLC Antibody - Azide and BSA Free
Background
The CLCF1 gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1(CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic factor
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Mu, Rt
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: Neut, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Neut, WB
Publications for CLC Antibody (H00023529-B03P) (0)
There are no publications for CLC Antibody (H00023529-B03P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CLC Antibody (H00023529-B03P) (0)
There are no reviews for CLC Antibody (H00023529-B03P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CLC Antibody (H00023529-B03P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CLC Products
Research Areas for CLC Antibody (H00023529-B03P)
Find related products by research area.
|
Blogs on CLC