Recombinant Human Claudin-5 Protein

Images

 
Recombinant Human Claudin-5 Protein [H00007122-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Claudin-5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-218 of Human CLDN5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CLDN5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
49.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00007122-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Claudin-5 Protein

  • AWAL
  • AWALTransmembrane protein deleted in VCFS
  • BEC1
  • claudin 5
  • Claudin5
  • Claudin-5
  • CLDN5
  • CPETRL1
  • TMDVCF
  • TMVCF1
  • TMVCFTMDVCF
  • transmembrane protein deleted in velocardiofacial syndrome

Background

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, KO
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-85683
Species: Hu
Applications: IHC, IHC-P
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
MAB4219
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-58264
Species: Hu
Applications: ICC/IF
AF1002
Species: Mu
Applications: WB, Simple Western, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Claudin-5 Recombinant Protein (H00007122-P01)(1)

We have publications tested in 1 application: ELISA.


Filter By Application
ELISA
(1)
All Applications
Filter By Species
All Species

Reviews for Claudin-5 Recombinant Protein (H00007122-P01) (0)

There are no reviews for Claudin-5 Recombinant Protein (H00007122-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Claudin-5 Recombinant Protein (H00007122-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Claudin-5 Recombinant Protein (H00007122-P01)

Discover related pathways, diseases and genes to Claudin-5 Recombinant Protein (H00007122-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-5 Recombinant Protein (H00007122-P01)

Discover more about diseases related to Claudin-5 Recombinant Protein (H00007122-P01).
 

Pathways for Claudin-5 Recombinant Protein (H00007122-P01)

View related products by pathway.

PTMs for Claudin-5 Recombinant Protein (H00007122-P01)

Learn more about PTMs related to Claudin-5 Recombinant Protein (H00007122-P01).
 

Research Areas for Claudin-5 Recombinant Protein (H00007122-P01)

Find related products by research area.

Blogs on Claudin-5

There are no specific blogs for Claudin-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Claudin-5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN5