Recombinant Human Claudin-5 GST (N-Term) Protein

SDS-Page: Recombinant Human Claudin-5 Protein [H00007122-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue

• Reactivity: Hu
• Applications: WB, ELISA, MA, AP

Recombinant Human Claudin-5 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 29-81 of Human Claudin-5
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: CLDN5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 31.57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Claudin-5 GST (N-Term) Protein

• AWAL
• AWALTransmembrane protein deleted in VCFS
• BEC1
• claudin 5
• Claudin5
• Claudin-5
• CLDN5
• CPETRL1
• TMDVCF
• TMVCF1
• TMVCFTMDVCF
• transmembrane protein deleted in velocardiofacial syndrome

Background

CLDN5 - claudin 5 (transmembrane protein deleted in velocardiofacial syndrome)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Claudin-5 Partial Recombinant Protein (H00007122-Q01)(1)

Publication using H00007122-Q01

• Annunziata P, Cioni C, Masi G et al. Fingolimod reduces circulating tight-junction protein levels and in vitro peripheral blood mononuclear cells migration in multiple sclerosis patients. Sci Rep 2018-10-18 [PMID: 30337577]

Bioinformatics

• Gene Symbol: CLDN5