Home » Claudin-2 » Claudin-2 Antibodies » Claudin-2 Antibody

Claudin-2 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: Claudin-2 Antibody [NBP2-58264] - Staining of human cell line CACO-2 shows localization to nucleoplasm & cell junctions. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: Claudin-2 Antibody [NBP2-58264] - Staining of human cell line CACO-2 shows localization to nucleoplasm & cell junctions. Antibody staining is shown in green.

Product Details

Summary
Product Discontinued
View other related Claudin-2 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-58264
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Claudin-2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV
Specificity
Specificity of human Claudin-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLDN2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID: 30110679).
Publications
Read Publication using
NBP2-58264 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse 85%, Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Claudin-2 Antibody

  • claudin 2
  • Claudin2
  • Claudin-2
  • CLDN2
  • SP82

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Claudin-1 Antibody
(1C5-D9)
H00009076-M01
Western Blot: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - CLDN1 monoclonal antibody (M01), clone 1C5-D9. Analysis of CLDN1 expression in A-431.
Immunohistochemistry-Paraffin: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - Analysis of monoclonal antibody to CLDN1 on formalin-fixed paraffin-embedded human colon. Antibody concentration 5 ug/ml.
Western Blot: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - CLDN1 monoclonal antibody (M01), clone 1C5-D9. Analysis of CLDN1 expression in PRC/PRF/5.
(2 Reviews)
(24 Publications)
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, S-ELISA
Claudin-7 Antibody
(6-G3)
NBP2-66784
Western Blot: Claudin-7 Antibody (6-G3) [NBP2-66784] - Analysis on SW480 cell lysate using anti- CLDN7 mouse mAb.
Immunocytochemistry/Immunofluorescence: Claudin-7 Antibody (6-G3) [NBP2-66784] - Staining CLDN7 in SW480 cells (red). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Claudin-4 Antibody
NBP2-41187
Western Blot: Claudin-4 Antibody [NBP2-41187] - Western Blot Validation in Human Colon Tissue Lysate. Loading: 15 ug of lysates per lane. Antibodies: CLAUDIN4, NBP2-41187 (Lane 1: 1 ug/mL and Lane 2: 2 ug/mL), 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
Western Blot: Claudin-4 Antibody [NBP2-41187] - Independent Antibody Validation (IAV) via Protein Expression Profile in Human Cell Lines. Loading: 15 ug of lysates per lane. Antibodies: CLAUDIN4, NBP2-41187 (1 ug/mL), CLAUDIN4 from Company B (1 ug/mL), and beta-actin (1 ug/mL), 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
Western Blot: Claudin-4 Antibody [NBP2-41187] - Western Blot Validation in Human Cell Lines. Loading: 15 ug of lysates per lane.Antibodies: CLAUDIN4, NBP2-41187 (1 ug/mL), 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
(1 Publication)
Species: Hu
Applications: WB, ELISA, IF
Claudin-3 Antibody
(385021) [Unconjugate ...
MAB4620
Claudin‑3 was detected in immersion fixed PC‑3 human prostate cancer cell line using Mouse Anti-Human Claudin‑3 Monoclonal Antibody (Catalog # MAB4620) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
PC‑3 human prostate cancer cell line was stained with Mouse Anti-Human Claudin‑3 Monoclonal Antibody (Catalog # MAB4620, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B).
Claudin‑3 was detected in immersion fixed paraffin-embedded sections of human colon array using Mouse Anti-Human Claudin‑3 Monoclonal Antibody (Catalog # MAB4620) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
Occludin Antibody
NBP1-87402
Western Blot: Occludin Antibody [NBP1-87402] - Analysis in human cell line CACO-2 and human cell line HeLa.
Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control siRNA. Primary antibody was diluted 1:1000. Image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Occludin Antibody [NBP1-87402] - Staining of human cell line A-431 shows localization to plasma membrane & cell junctions. Antibody staining shown in green.
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Tight Junction
Protein 1 Antibody
NBP1-85047
Knockout Validated: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and TJP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:200 of Rabbit Anti-Human TJP1 Polyclonal Antibody (Catalog # NBP1-85047) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TJP1 at approximately 260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in human cell line A-431.
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Rat epithelial cells stained positively with Tight Junction Protein 1. Primary antibody at 1:100. Secondary antibody: goat anti-rabbit-Alexa 488 conjugated at 1:500. ICC/IF image submitted by a verified customer review.
(5 Reviews)
(7 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
Occludin Antibody
NBP1-87402
Western Blot: Occludin Antibody [NBP1-87402] - Analysis in human cell line CACO-2 and human cell line HeLa.
Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control siRNA. Primary antibody was diluted 1:1000. Image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Occludin Antibody [NBP1-87402] - Staining of human cell line A-431 shows localization to plasma membrane & cell junctions. Antibody staining shown in green.
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Claudin-5 Antibody
(OTI1G4)
NBP2-02259
Immunocytochemistry/Immunofluorescence: Claudin-5 Antibody (OTI1G4) [NBP2-02259] - Claudin-5 labeled pig SC cells visualized by alexa 594. ICC/IF image submitted by a verified customer review.
Flow Cytometry: Claudin-5 Antibody (1G4) [NBP2-02259] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Claudin 5 antibody, and then analyzed by flow cytometry.
Immunocytochemistry/Immunofluorescence: Claudin-5 Antibody (1G4) [NBP2-02259] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Claudin 5.
(1 Review)
Species: Hu, Mu, Rt, Po
Applications: Flow, ICC/IF
E-Cadherin
Antibody [Unconjugate
AF748
E‑Cadherin was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human/MouseE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
E‑Cadherin was detected in perfusion fixed frozen sections of mouse skin using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membranes in keratinocytes. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
E‑Cadherin was detected in immersion fixed mouse intestinal organoids using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (green; Catalog # NL001) and counterstained with DAPI (blue). Magnification shown at 100X (upper panel) and 40X (lower panel). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(7 Reviews)
(35 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(33 Reviews)
(647 Publications)
Species: Hu
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
IL-13 [HRP]
M1300CB
(3 Reviews)
(113 Publications)
Species: Mu
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Activity of Wnt/beta-catenin pathway in the embryonic chick lung. Western blot analysis of active and total beta-catenin in stage b1, b2 and b3 lungs, and stage 24 limb (as positive control). Control loading was performed using beta-tubulin (55 kDa). Total and active beta-catenin correspond to 92 kDa. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0112388), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
(4 Reviews)
(12 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(21 Reviews)
(458 Publications)
Species: Hu
Synaptic
glycoprotein SC2 Anti
NBP2-49230
Western Blot: Synaptic glycoprotein SC2 Antibody [NBP2-49230] - Analysis in control (vector only transfected HEK293T lysate) and TECR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: Synaptic glycoprotein SC2 Antibody [NBP2-49230] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: Synaptic glycoprotein SC2 Antibody [NBP2-49230] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Claudin-8 Antibody
NBP1-59157
Western Blot: Claudin-8 Antibody [NBP1-59157] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: Claudin-8 Antibody [NBP1-59157] - Human Intestine
Western Blot: Claudin-8 Antibody [NBP1-59157] - Claudin 8 Antibody [NBP1-59157] - HepG2 cell lysate, Antibody Titration: 0.5-1.0ug/ml
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
EGFR Antibody
(DH8.3) - EGFRvIII, M ...
NBP2-50599
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
(5 Publications)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
Claudin-15 Antibody
H00024146-D01P
Western Blot: Claudin-15 Antibody [H00024146-D01P] - Analysis of CLDN15 expression in human kidney.
Flow Cytometry: Claudin-15 Antibody [H00024146-D01P] - Flow cytometry image submitted by a verified customer review.
Western Blot: Claudin-15 Antibody [H00024146-D01P] - Analysis of CLDN15 expression in transfected 293T cell line by CLDN15 polyclonal antibody.Lane 1: CLDN15 transfected lysate(24.40 KDa).Lane 2: Non-transfected lysate.
(1 Review)
Species: Hu
Applications: WB
Claudin-2 Antibody
NBP2-58264
Claudin-2 Antibody
Species: Hu
Applications: WB, ICC/IF

Publications for Claudin-2 Antibody (NBP2-58264)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Claudin-2 Antibody (NBP2-58264) (0)

There are no reviews for Claudin-2 Antibody (NBP2-58264). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Claudin-2 Antibody (NBP2-58264) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Claudin-2 Products

Bioinformatics Tool for Claudin-2 Antibody (NBP2-58264)

Discover related pathways, diseases and genes to Claudin-2 Antibody (NBP2-58264). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-2 Antibody (NBP2-58264)

Discover more about diseases related to Claudin-2 Antibody (NBP2-58264).
 

Pathways for Claudin-2 Antibody (NBP2-58264)

View related products by pathway.

PTMs for Claudin-2 Antibody (NBP2-58264)

Learn more about PTMs related to Claudin-2 Antibody (NBP2-58264).
 

Research Areas for Claudin-2 Antibody (NBP2-58264)

Find related products by research area.

Blogs on Claudin-2

There are no specific blogs for Claudin-2, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Claudin-2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CLDN2