Claudin-2 Antibody

Immunocytochemistry/Immunofluorescence: Claudin-2 Antibody [NBP2-58264] - Staining of human cell line CACO-2 shows localization to nucleoplasm & cell junctions. Antibody staining is shown in green.

Product Discontinued

Claudin-2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLDN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID: 30110679).

Reactivity Notes

Mouse 85%, Rat 85%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Claudin-2 Antibody

• claudin 2
• Claudin2
• Claudin-2
• CLDN2
• SP82

Background

The Claudin superfamily consists of many structurally related proteins in humans. These proteins are important structural and functional components of tight junctions in paracellular transport. Claudins are located in both epithelial and endothelial cells in all tight junction-bearing tissues. Three classes of proteinsare known to localize to tight junctions, including the Claudins, Occludin and junction adhesion molecule (JAM). Claudins, which consist of four transmembrane domains and two extracellular loops, make up tight junction strands. Emerging evidence suggests that the Claudin family of proteins regulates transport through tight junctions via differential discrimination for solute size and charge. Claudin expression is often highly restricted to specfic regions of different tissues and may have an important role in transcellular transport through tight junctions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Claudin-2 Antibody (NBP2-58264)(1)

Publication using NBP2-58264

• Cheng CW, Yu JC, Hsieh YH et al. Increased Cellular Levels of MicroRNA-9 and MicroRNA-221 Correlate with Cancer Stemness and Predict Poor Outcome in Human Breast Cancer Cell. Physiol. Biochem. 2018-08-15 [PMID: 30110679] (WB, Human)

Bioinformatics

• Gene Symbol: CLDN2