Claudin-2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Claudin-2 Antibody [NBP2-58264] - Staining of human cell line CACO-2 shows localization to nucleoplasm & cell junctions. Antibody staining is shown in green.

Product Details

Summary
Product Discontinued
View other related Claudin-2 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-58264
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Claudin-2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV
Specificity
Specificity of human Claudin-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLDN2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID: 30110679).
Publications
Read Publication using
NBP2-58264 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse 85%, Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Claudin-2 Antibody

  • claudin 2
  • Claudin2
  • Claudin-2
  • CLDN2
  • SP82

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009076-M01
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-66784
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-41187
Species: Hu
Applications: WB, ELISA, IF
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-87402
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-85047
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP1-87402
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-02259
Species: Hu, Mu, Rt, Po
Applications: Flow, ICC/IF
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-49230
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59157
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
H00024146-D01P
Species: Hu
Applications: WB
NBP2-58264
Species: Hu
Applications: WB, ICC/IF

Publications for Claudin-2 Antibody (NBP2-58264)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Claudin-2 Antibody (NBP2-58264) (0)

There are no reviews for Claudin-2 Antibody (NBP2-58264). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Claudin-2 Antibody (NBP2-58264) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Claudin-2 Products

Bioinformatics Tool for Claudin-2 Antibody (NBP2-58264)

Discover related pathways, diseases and genes to Claudin-2 Antibody (NBP2-58264). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-2 Antibody (NBP2-58264)

Discover more about diseases related to Claudin-2 Antibody (NBP2-58264).
 

Pathways for Claudin-2 Antibody (NBP2-58264)

View related products by pathway.

PTMs for Claudin-2 Antibody (NBP2-58264)

Learn more about PTMs related to Claudin-2 Antibody (NBP2-58264).
 

Research Areas for Claudin-2 Antibody (NBP2-58264)

Find related products by research area.

Blogs on Claudin-2

There are no specific blogs for Claudin-2, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Claudin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN2