Recombinant Human CLASP1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CLASP1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1133-1226 of Human CLASP1

Source: Wheat Germ

Amino Acid Sequence: DGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFSFRSQEDLNEPIKRDGKKECDIVSRDGGAASPAT

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CLASP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.08 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00023332-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CLASP1 Protein

  • CLIP-associating protein 1
  • cytoplasmic linker associated protein 1
  • Cytoplasmic linker-associated protein 1
  • DKFZp686D1968
  • DKFZp686H2039
  • hOrbit1
  • KIAA0622FLJ33821
  • MAST1FLJ41222
  • MGC131895
  • multiple asters 1
  • Multiple asters homolog 1
  • Protein Orbit homolog 1

Background

CLASP1 - cytoplasmic linker associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-21395
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-89788
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-66137
Species: Hu
NBP1-84928
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74638
Species: Hu
Applications: WB (-), ICC/IF, IP
H00056899-P01
Species: Hu
NBP1-83017
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89273
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00026119-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009167-B02P
Species: Hu
Applications: WB, ELISA
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-85568
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38238
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-338
Species: Hu, Rt, Ha
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP

Publications for CLASP1 Partial Recombinant Protein (H00023332-Q01)(1)

We have publications tested in 1 application: In vitro.


Filter By Application
In vitro
(1)
All Applications
Filter By Species
All Species
Showing Publication 1 - 1 of 1.
Publication using H00023332-Q01 Applications Species
Zhao X. Identification and Characterization of Protein Kinase C Substrates in Human Breast Cells. Thesis. 2014 Oct 01 (In vitro)

Details:
CLASP1 protein used for in vitro kinase assay
In vitro

Reviews for CLASP1 Partial Recombinant Protein (H00023332-Q01) (0)

There are no reviews for CLASP1 Partial Recombinant Protein (H00023332-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLASP1 Partial Recombinant Protein (H00023332-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for CLASP1 Partial Recombinant Protein (H00023332-Q01)

Discover related pathways, diseases and genes to CLASP1 Partial Recombinant Protein (H00023332-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLASP1 Partial Recombinant Protein (H00023332-Q01)

Discover more about diseases related to CLASP1 Partial Recombinant Protein (H00023332-Q01).
 

Pathways for CLASP1 Partial Recombinant Protein (H00023332-Q01)

View related products by pathway.

PTMs for CLASP1 Partial Recombinant Protein (H00023332-Q01)

Learn more about PTMs related to CLASP1 Partial Recombinant Protein (H00023332-Q01).

Blogs on CLASP1

There are no specific blogs for CLASP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CLASP1 Antibody
NBP2-15910

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CLASP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLASP1