CLASP1 Antibody [Janelia Fluor® 669]

Product Discontinued

CLASP1 Antibody [Janelia Fluor® 669] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1389-1538 of human CLASP1 (NP_056097.1).
  
  Sequence:
  IMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTADYPINLAAIKMQTKVVERIAKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLKPHLAQLTGSKMKLLNLYIKRAQTTNSNSSSSSDVSTHS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLASP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.

Alternate Names for CLASP1 Antibody [Janelia Fluor® 669]

• CLIP-associating protein 1
• cytoplasmic linker associated protein 1
• Cytoplasmic linker-associated protein 1
• DKFZp686D1968
• DKFZp686H2039
• hOrbit1
• KIAA0622FLJ33821
• MAST1FLJ41222
• MGC131895
• multiple asters 1
• Multiple asters homolog 1
• Protein Orbit homolog 1

Background

CLASPs, such as CLASP1, are nonmotor microtubule-associated proteins that interact with CLIPs (e.g., CLIP170; MIM 179838). CLASP1 is involved in the regulation of microtubule dynamics at the kinetochore and throughout the spindle (Maiato et al., 2003 [PubMed 12837247]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLASP1