CLASP1 Antibody (6E10) - Azide and BSA Free

Western Blot: CLASP1 Antibody (6E10) [H00023332-M01] - Detection against Immunogen (36.08 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6E10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CLASP1 Antibody (6E10) - Azide and BSA Free Summary

• Immunogen: CLASP1 (NP_056097, 1133 a.a. ~ 1226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFSFRSQEDLNEPIKRDGKKECDIVSRDGGAASPAT
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CLASP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CLASP1 Antibody (6E10) - Azide and BSA Free

• CLIP-associating protein 1
• cytoplasmic linker associated protein 1
• Cytoplasmic linker-associated protein 1
• DKFZp686D1968
• DKFZp686H2039
• hOrbit1
• KIAA0622FLJ33821
• MAST1FLJ41222
• MGC131895
• multiple asters 1
• Multiple asters homolog 1
• Protein Orbit homolog 1

Background

CLASPs, such as CLASP1, are nonmotor microtubule-associated proteins that interact with CLIPs (e.g., CLIP170; MIM 179838). CLASP1 is involved in the regulation of microtubule dynamics at the kinetochore and throughout the spindle (Maiato et al., 2003 [PubMed 12837247]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLASP1
• Uniprot:
  • NP_056097(Human)