CL-K1/COLEC11 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human COLEC11. Peptide sequence: RETKAPPDGLEESAPREKKQSQPVVTASDISKRKCTSSFVEMGSQGDMGD The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
COLEC11 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for CL-K1/COLEC11 Antibody - BSA Free
Background
COLEC11 is a member of the collectin family of C-type lectins, which contain a collagen-like domain and a carbohydraterecognition domain, and play a role in host-defense (Keshi et al., 2006 (PubMed 17179669)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Species: Hu
Applications: ICC/IF, KD, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu, Mu, Po, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Publications for CL-K1/COLEC11 Antibody (NBP2-82698) (0)
There are no publications for CL-K1/COLEC11 Antibody (NBP2-82698).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CL-K1/COLEC11 Antibody (NBP2-82698) (0)
There are no reviews for CL-K1/COLEC11 Antibody (NBP2-82698).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CL-K1/COLEC11 Antibody (NBP2-82698) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CL-K1/COLEC11 Products
Research Areas for CL-K1/COLEC11 Antibody (NBP2-82698)
Find related products by research area.
|
Blogs on CL-K1/COLEC11