Recombinant Human CIRH1A Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CIRH1A Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 587-686 of Human CIRH1A

Source: Wheat Germ

Amino Acid Sequence: SFHPKRPMHILLHDAYMFCIIDKSLPLPNDKTLLYNPFPPTNESDVIRRRTAHAFKISKIYKPLLFMDLLDERTLVAVERPLDDIIAQLPPPIKKKKFGT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CIRH1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CIRH1A Protein

  • CIRHIN
  • cirrhosis, autosomal recessive 1A (cirhin)
  • FLJ14728
  • KIAA1988FLJ17146
  • NAICcirhin
  • TEX292testis expressed gene 292

Background

CIRH1A - cirrhosis, autosomal recessive 1A (cirhin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30785
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90226
Species: Hu
Applications: IHC, IHC-P
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-30876
Species: Hu
Applications: IHC, IHC-P
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM, ICC
NBP1-90522
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90068
Species: Hu
Applications: IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86850
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20874
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85683
Species: Hu
Applications: IHC, IHC-P
AF3635
Species: Mu
Applications: WB, IHC
NBP2-19561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45478
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CIRH1A Partial Recombinant Protein (H00084916-Q01) (0)

There are no publications for CIRH1A Partial Recombinant Protein (H00084916-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CIRH1A Partial Recombinant Protein (H00084916-Q01) (0)

There are no reviews for CIRH1A Partial Recombinant Protein (H00084916-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CIRH1A Partial Recombinant Protein (H00084916-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CIRH1A Products

Bioinformatics Tool for CIRH1A Partial Recombinant Protein (H00084916-Q01)

Discover related pathways, diseases and genes to CIRH1A Partial Recombinant Protein (H00084916-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CIRH1A Partial Recombinant Protein (H00084916-Q01)

Discover more about diseases related to CIRH1A Partial Recombinant Protein (H00084916-Q01).
 

Pathways for CIRH1A Partial Recombinant Protein (H00084916-Q01)

View related products by pathway.

PTMs for CIRH1A Partial Recombinant Protein (H00084916-Q01)

Learn more about PTMs related to CIRH1A Partial Recombinant Protein (H00084916-Q01).

Blogs on CIRH1A

There are no specific blogs for CIRH1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CIRH1A Antibody
NBP1-91789

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CIRH1A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CIRH1A