NOL11 Antibody

Images

 
Western Blot: NOL11 Antibody [NBP1-90522] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: NOL11 Antibody [NBP1-90522] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
Immunohistochemistry-Paraffin: NOL11 Antibody [NBP1-90522] - Staining of human hippocampus shows strong nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NOL11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FTLSSVVLSAGPEGLLGVEQSDKTDQFLVTDSGRTVILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGEYVVVHDNKVLRIWNNEDVNL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOL11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NOL11 Protein (NBP1-90522PEP)
Publications
Read Publications using
NBP1-90522 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25756904). Rat (87%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NOL11 Antibody

  • nucleolar protein 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-97838
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-93788
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-13251
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP3-09260
Species: Hu
Applications: WB
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
H00006159-B02P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP2-32572
Species: Hu
Applications: WB, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP2-38971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20210
Species: Hu, Mu, I
Applications: WB, IHC, IHC-P
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-90522
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NOL11 Antibody (NBP1-90522)(3)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
Mouse
(1)
All Species

Reviews for NOL11 Antibody (NBP1-90522) (0)

There are no reviews for NOL11 Antibody (NBP1-90522). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOL11 Antibody (NBP1-90522) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NOL11 Products

Array NBP1-90522

Bioinformatics Tool for NOL11 Antibody (NBP1-90522)

Discover related pathways, diseases and genes to NOL11 Antibody (NBP1-90522). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOL11 Antibody (NBP1-90522)

Discover more about diseases related to NOL11 Antibody (NBP1-90522).
 

Pathways for NOL11 Antibody (NBP1-90522)

View related products by pathway.

PTMs for NOL11 Antibody (NBP1-90522)

Learn more about PTMs related to NOL11 Antibody (NBP1-90522).

Blogs on NOL11

There are no specific blogs for NOL11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOL11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOL11