Cip4 Antibody (1A9)

Images

 
Immunocytochemistry/ Immunofluorescence: Cip4 Antibody (1A9) [H00009322-M01] - Analysis of monoclonal antibody to TRIP10 on HeLa cell. Antibody concentration 10 ug/ml.
Immunoprecipitation: Cip4 Antibody (1A9) [H00009322-M01] - Analysis of TRIP10 transfected lysate using anti-TRIP10 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIP10 MaxPab rabbit polyclonal ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP
Clone
1A9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cip4 Antibody (1A9) Summary

Immunogen
TRIP10 (NP_004231, 231 a.a. ~ 329 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YGLLSEAELEVVPIIAKCLEGMKVAANAVDPKNDSHVLIELHKSGFARPGDVEFEDFSQPMNRAPSDSSLGTPSDGRPELRGPGRSRTKRWPFGKKNKT
Specificity
TRIP10 (1A9)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRIP10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunoprecipitation 1:10-1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Control
Cip4 Knockout 293T Cell Lysate

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cip4 Antibody (1A9)

  • cdc42-interacting protein 4
  • CIP4STOT
  • HSTP
  • Protein Felic
  • Salt tolerant protein
  • salt tolerator
  • STPTRIP-10
  • thyroid hormone receptor interactor 10
  • thyroid receptor interacting protein 10
  • Thyroid receptor-interacting protein 10
  • TR-interacting protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88191
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-76845
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NB300-996
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB6460
Species: Hu
Applications: WB, IHC
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP1-20089
Species: Hu
Applications: WB, ICC/IF, KD
NBP1-82512
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-15134
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, ICC/IF, IF
H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP

Publications for Cip4 Antibody (H00009322-M01) (0)

There are no publications for Cip4 Antibody (H00009322-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cip4 Antibody (H00009322-M01) (0)

There are no reviews for Cip4 Antibody (H00009322-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cip4 Antibody (H00009322-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Cip4 Products

Bioinformatics Tool for Cip4 Antibody (H00009322-M01)

Discover related pathways, diseases and genes to Cip4 Antibody (H00009322-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cip4 Antibody (H00009322-M01)

Discover more about diseases related to Cip4 Antibody (H00009322-M01).
 

Pathways for Cip4 Antibody (H00009322-M01)

View related products by pathway.

PTMs for Cip4 Antibody (H00009322-M01)

Learn more about PTMs related to Cip4 Antibody (H00009322-M01).

Blogs on Cip4

There are no specific blogs for Cip4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cip4 Antibody (1A9) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIP10
Entrez
OMIM
Uniprot