CHRFAM7A Antibody

Images

 
Western Blot: CHRFAM7A Antibody [NBP1-80090] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Western Blot: CHRFAM7A Antibody [NBP1-80090] - 293T cells lysate, concentration 0.2-1 ug/ml.
Western Blot: CHRFAM7A Antibody [NBP1-80090] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml CHRFAM7A is supported by BioGPS gene expression data to be expressed in 721_B.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

CHRFAM7A Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the middle region of human CHRFAM7A. Peptide Sequence: QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRM The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRFAM7A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for CHRFAM7A Antibody

  • CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (familywith sequence similarity 7A, exons A-E) fusion
  • CHRNA7 (cholinergic receptor, nicotinic, alpha polypeptide 7, exons 5-10) andFAM7A (family with sequence similarity 7A, exons A-E) fusion
  • CHRNA7
  • CHRNA7-DR1alpha 7 neuronal nicotinic acetylcholine receptor-FAM7A hybrid
  • CHRNA7-FAM7A fusion protein
  • D-10alpha-7 nicotinic cholinergic receptor subunit
  • MGC120482
  • MGC120483

Background

CHRFAM7A is a gene that codes for a multi-pass membrane protein expressed in the hippocampus that is 412 amino acids long and weighs approximately 46 kDa. Current studies are being done on diseases and disorders related to this gene including neuronitis, Alzheimer's disease, juvenile myoclonic epilepsy, bipolar affective disorder, schizoaffective disorder, pharyngitis, and dementia. CHRFAM7A has been shown to have involvement in pathways such as the SIDS susceptibility pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61674
Species: Hu
Applications: ELISA, WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-88650
Species: Hu
Applications: IHC, IHC-P, KD, WB
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP1-28467
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
NBP2-61677
Species: Hu, Rt
Applications: ELISA, Flow, WB
NBP2-61667
Species: Hu, Rt
Applications: ELISA, WB
NBP2-61743
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
DBD00
Species: Hu
Applications: ELISA
H00001142-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP3-25636
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-61673
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP1-85299
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80090
Species: Hu
Applications: WB

Publications for CHRFAM7A Antibody (NBP1-80090) (0)

There are no publications for CHRFAM7A Antibody (NBP1-80090).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHRFAM7A Antibody (NBP1-80090) (0)

There are no reviews for CHRFAM7A Antibody (NBP1-80090). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHRFAM7A Antibody (NBP1-80090) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHRFAM7A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRFAM7A
Uniprot