Novus Biologicals products are now on bio-techne.com

Recombinant Human Cholecystokinin GST (N-Term) Protein

Images

 
Recombinant Human Cholecystokinin Protein [H00000885-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human Cholecystokinin GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-115 of Human CCK full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
CCK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
38.39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cholecystokinin GST (N-Term) Protein

  • CCK
  • cholecystokinin
  • MGC117187

Background

CCK( AAH08283, 1 a.a. - 116 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48988
Species: Hu
Applications: IHC, IHC-P
NB100-2803
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP3-12223
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF2680
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NBP2-46349
Species: Hu
Applications: IHC, WB
NBP3-03282
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MAB8864
Species: Hu
Applications: IHC
AF4499
Species: Hu, Mu, Rt
Applications: Simple Western, WB
DLP00
Species: Hu
Applications: ELISA
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
H00000885-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Cholecystokinin Recombinant Protein (H00000885-P01) (0)

There are no publications for Cholecystokinin Recombinant Protein (H00000885-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cholecystokinin Recombinant Protein (H00000885-P01) (0)

There are no reviews for Cholecystokinin Recombinant Protein (H00000885-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cholecystokinin Recombinant Protein (H00000885-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cholecystokinin Products

Research Areas for Cholecystokinin Recombinant Protein (H00000885-P01)

Find related products by research area.

Blogs on Cholecystokinin

There are no specific blogs for Cholecystokinin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cholecystokinin GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CCK