We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Cholecystokinin Recombinant Protein Antigen

Images

 
There are currently no images for Cholecystokinin Recombinant Protein Antigen (NBP2-62664PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cholecystokinin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cholecystokinin.

Source: E. coli

Amino Acid Sequence: LQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62664.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cholecystokinin Recombinant Protein Antigen

  • CCK
  • cholecystokinin
  • MGC117187

Background

The regulated translation of messenger RNA is essential for cell-cycle progression, establishment of the body plan during early development and modulation of key activities in the central nervous system. Cytoplasmic polyadenylation, one mechanism of controlling translation, is driven by cytoplasmic polyadenylation element binding protein, CPEB. CPEB is a highly conserved, sequence-specific RNA-binding protein that binds to the cytoplasmic polyadenylation element, thereby modulating translational repression and mRNA localization. Blocking cytoplasmic polyadenylation by interfering with the CPE or CPEB prevents the translational activation and translational repression of mRNAs crucial for oocyte maturation. CPEB is synthesized during oogenesis and stockpiled in the oocyte. CPEB degradation occurs via the proteasome pathway, most likely through ubiquitin-conjugated intermediates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-82534
Species: Hu
Applications: ELISA
NB100-2803
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP3-08148
Species: Mu
Applications: ELISA
NB100-2805
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
NBP2-82390
Species: Hu
Applications: ELISA
NBP3-03282
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP2-33903
Species: Hu
Applications: IHC,  IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-80865
Species: Hu
Applications: IHC,  IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-82161
Species: Hu
Applications: ELISA
AF4499
Species: Hu, Mu, Rt
Applications: Simple Western, WB
DLP00
Species: Hu
Applications: ELISA
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP2-62664PEP
Species: Hu
Applications: AC

Publications for Cholecystokinin Recombinant Protein Antigen (NBP2-62664PEP) (0)

There are no publications for Cholecystokinin Recombinant Protein Antigen (NBP2-62664PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cholecystokinin Recombinant Protein Antigen (NBP2-62664PEP) (0)

There are no reviews for Cholecystokinin Recombinant Protein Antigen (NBP2-62664PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cholecystokinin Recombinant Protein Antigen (NBP2-62664PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cholecystokinin Products

Research Areas for Cholecystokinin Recombinant Protein Antigen (NBP2-62664PEP)

Find related products by research area.

Blogs on Cholecystokinin

There are no specific blogs for Cholecystokinin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cholecystokinin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CCK