CHMP4C Antibody - BSA Free

Western Blot: CHMP4C Antibody [NBP2-87185] - Host: Rabbit. Target Name: Chmp4c. Sample Type: Mouse Liver lysates. Antibody Dilution: 1.0ug/ml

Western Blot: CHMP4C Antibody [NBP2-87185] - Host: Rabbit. Target Name: CHMP4C. Sample Tissue: Mouse Mouse Spleen. Antibody Dilution: 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CHMP4C Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse CHMP4C. Peptide sequence: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHMP4C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CHMP4C Antibody - BSA Free

• charged multivesicular body protein 4c
• CHMP4c
• chromatin modifying protein 4C
• Chromatin-modifying protein 4c
• hSnf7-3
• hVps32-3
• MGC22825
• Shax3
• SNF7 homolog associated with Alix 3
• Snf7 homologue associated with Alix 3
• SNF7-3
• Vacuolar protein sorting-associated protein 32-3
• vps32-3
• VPS32C

Background

CHMP4C belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHMP4C