CHMP2B Antibody (3L9O5) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 114-213 of human CHMP2B (Q9UQN3). KKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
CHMP2B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CHMP2B Antibody (3L9O5)
Background
Component of the escrt-iii complex, which is required for multivesicular bodies (mvbs) formation and sorting of endosomal cargo proteins into mvbs. the mvb pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. the escrt-iii complex is probably involved in the concentration of mvb cargo. in case of infection, the hiv-1 virus takes advantage of the escrt-iii complex for budding and exocytic cargos of viral proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Publications for CHMP2B Antibody (NBP3-15707) (0)
There are no publications for CHMP2B Antibody (NBP3-15707).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CHMP2B Antibody (NBP3-15707) (0)
There are no reviews for CHMP2B Antibody (NBP3-15707).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CHMP2B Antibody (NBP3-15707) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CHMP2B Products
Research Areas for CHMP2B Antibody (NBP3-15707)
Find related products by research area.
|
Blogs on CHMP2B