Chk1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Chk1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Chk1.

  Source: E. coli

  Amino Acid Sequence: KRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDFSPVNSASSE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CHEK1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58441.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Chk1 Recombinant Protein Antigen

• Checkpoint, S. pombe, homolog of, 1
• CHEK1
• CHK1 (checkpoint, S.pombe) homolog
• CHK1 checkpoint homolog (S. pombe)
• Chk1
• CHK1serine/threonine-protein kinase Chk1
• EC 2.7.11
• EC 2.7.11.1

Background

Chk1 is involved in cell cycle arrest when DNA damage has occurred, and it plays an important role in DNA damage checkpoint, embryonic development and tumor suppression (1). Chk1 is activated in response to replication blocks and genotoxic stress, via phosphorylation of serines 317 and 345 (2). Activated Chk1 can bind to, phosphorylate (at serine 216) and inactivate cdc25c (3,4). Phosphorylation of cdc25c prevents activation of the CDC2-cyclin B complex and prevents entry into M-phase (3, 4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CHEK1