Chitinase 3-like 2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CHI3L2 Antibody [NBP1-86845] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry-Paraffin: CHI3L2 Antibody [NBP1-86845] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Chitinase 3-like 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHI3L2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Chitinase 3-like 2 Protein (NBP1-86845PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Chitinase 3-like 2 Antibody

  • CHI3L2
  • Chitinase 3 like 2
  • Chitinase 3-like 2
  • chitinase-3-like protein 2
  • Chondrocyte protein 39
  • YKL39
  • YKL-39YKL39

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2599
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
AF2599
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-81901
Species: Hu
Applications: WB, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-87766
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-204
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83054
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86845
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Chitinase 3-like 2 Antibody (NBP1-86845) (0)

There are no publications for Chitinase 3-like 2 Antibody (NBP1-86845).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chitinase 3-like 2 Antibody (NBP1-86845) (0)

There are no reviews for Chitinase 3-like 2 Antibody (NBP1-86845). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Chitinase 3-like 2 Antibody (NBP1-86845) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Chitinase 3-like 2 Products

Bioinformatics Tool for Chitinase 3-like 2 Antibody (NBP1-86845)

Discover related pathways, diseases and genes to Chitinase 3-like 2 Antibody (NBP1-86845). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chitinase 3-like 2 Antibody (NBP1-86845)

Discover more about diseases related to Chitinase 3-like 2 Antibody (NBP1-86845).
 

Pathways for Chitinase 3-like 2 Antibody (NBP1-86845)

View related products by pathway.

PTMs for Chitinase 3-like 2 Antibody (NBP1-86845)

Learn more about PTMs related to Chitinase 3-like 2 Antibody (NBP1-86845).

Blogs on Chitinase 3-like 2

There are no specific blogs for Chitinase 3-like 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Chitinase 3-like 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHI3L2
Entrez