ChGn Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ChGn Antibody [NBP3-17694] - Staining of human cell line A549 shows localization to cytosol & the Golgi apparatus.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ChGn Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSGALNACT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ChGn Antibody - BSA Free

• beta4GalNAcT
• beta4GalNAcT-1
• ChGn
• chondroitin beta1,4 N-acetylgalactosaminyltransferase
• Chondroitin beta-1,4-N-acetylgalactosaminyltransferase 1
• chondroitin sulfate N-acetylgalactosaminyltransferase 1
• CSGalNAcT-1
• EC 2.4.1.174
• FLJ11264
• FLJ13760
• GALNACT1

Background

Transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). Required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains. Important role in chondroitin chain biosynthesis in cartilage

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSGALNACT1