Home » CHD1 » CHD1 Antibodies » CHD1 Antibody (1G2)

CHD1 Antibody (1G2)

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: CHD1 Antibody (1G2) [H00001105-M04] - Analysis of monoclonal antibody to CHD1 on HeLa cell. Antibody concentration 10 ug/ml
Immunocytochemistry/ Immunofluorescence: CHD1 Antibody (1G2) [H00001105-M04] - Analysis of monoclonal antibody to CHD1 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: CHD1 Antibody (1G2) [H00001105-M04] - Detection limit for recombinant GST tagged CHD1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1G2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CHD1 Antibody (1G2) Summary

Immunogen
CHD1 (NP_001261 1177 a.a. - 1272 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS
Specificity
Reacts with chromodomain helicase DNA binding protein 1.
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CHD1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.
Control
CHD1 Lysate (NBP2-65814)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CHD1 Antibody (1G2)

  • ATP-dependent helicase CHD1
  • CHD1
  • CHD-1
  • chromodomain helicase DNA binding protein 1
  • chromodomain-helicase-DNA-binding protein 1
  • DKFZp686E2337
  • EC 3.6.1
  • EC 3.6.4.12

Background

The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SMARCA1 Antibody
(2H7B8)
NBP2-61879
Western Blot: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis using SMARCA1 mAb against HEK293 (1) and SMARCA1 (AA: 933-1070)-hIgGFc transfected HEK293 (2) cell lysate.
Immunohistochemistry: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis of paraffin-embedded rectum cancer tissues using SMARCA1 mouse mAb with DAB staining.
Flow Cytometry: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis of NIH/3T3 cells using SMARCA1 mouse mAb (green) and negative control (red).
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
Histone H3 Antibody
NB500-171
Western Blot: Histone H3 Antibody [NB500-171] - Analysis of HeLa, COS, C6, and K562 cell lysate using histone H3 antibody [NB500-171] antibody at 1:100.
Western Blot: Histone H3 Antibody [NB500-171] - Total histone H3 levels in MCF-7 and HCT-116 cells. Image from verified customer review.
Western Blot: Histone H3 Antibody [NB500-171] - (1) HeLa, (2) S. cerevisiae whole cell lysates, (3) Histones purified from HeLa cells.
(4 Reviews)
(9 Publications)
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Brg1 Antibody
NB100-2594
Western Blot: Brg1 Antibody [NB100-2594] - Detection of Human and Mouse BRG1/SMARCA4 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells. Antibodies: Affinity purified rabbit anti-BRG1/SMARCA4 antibody NB100-2594 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry: Brg1 Antibody [NB100-2594] - Sample: FFPE section of mouse plasmacytoma. Antibody: Affinity purified rabbit anti-BRG1/SMARCA4 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB staining using Immunohistochemistry Accessory Kit.
Western Blot: Brg1 Antibody [NB100-2594] - Detection of Human and Mouse BRG1/SMARCA4 on HeLa whole cell lysate using NB100-2594.
(4 Publications)
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
BRM Antibody
NBP1-90015
Immunocytochemistry/Immunofluorescence: BRM Antibody [NBP1-90015] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BRM Antibody [NBP1-90015] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: BRM Antibody [NBP1-90015] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neuronal cells.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SMARCA5/SNF2H
Antibody
NB100-55310
Western Blot: SMARCA5/SNF2H Antibody [NB100-55310] - SNF2H Antibody [NB100-55310] - Detection of Human SNF2h/ISWI on HeLa whole cell lysate using NB100-55310. SNF2h/ISWI was also immunoprecipitated by rabbit anti-SNF2h/ISWI antibodies BL4495 and NB100-55311.
Western Blot: SNF2H Antibody [NB100-55310] - WB analysis of SNF2H in Mouse Stem Cell lysate. Verified customer review from 1DegreeBio.
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: WB, IP
PAF1 Antibody
NB600-273
Western Blot: PAF1 Antibody [NB600-273] - Whole cell lysate (15 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit antiPaf1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Western Blot: PAF1 Antibody [NB600-273] - Detection of Human and Mouse Paf1 by Western Blot. Samples: Whole cell lysate (50, 15 ug) from HeLa and (50 ug) from Mouse TCMK-1 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Paf1 antibody NB600-273 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: PAF1 Antibody [NB600-273] - Detection of Human Paf1 on HeLa whole cell lysate using NB600-273. In B, Paf1 was immunoprecipitated using NB600-274 and blotted using NB600-273 at 0.2 mcg/ml.
(5 Publications)
Species: Hu, Mu
Applications: WB, IP
CHD2 Antibody
NBP2-32563
Immunocytochemistry/Immunofluorescence: CHD2 Antibody [NBP2-32563] - Immunofluorescent staining of human cell line SiHa shows localization to nucleus & vesicles.
Immunohistochemistry-Paraffin: CHD2 Antibody [NBP2-32563] - Staining in human thyroid gland and liver tissues using anti-CHD2 antibody. Corresponding CHD2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CHD2 Antibody [NBP2-32563] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CENPA Antibody
(5A7-2E11)
NBP2-12892
Western Blot: CENPA Antibody (5A7-2E11) [NBP2-12892] - analysis of Human U2OS cell lysate showing detection of CENP-A protein using Mouse Anti-CENP-A Monoclonal Antibody, Clone 5A7-2E11. Primary Antibody: Mouse Anti-CENP-A Monoclonal Antibody at 1:1000.
Immunocytochemistry/Immunofluorescence: CENPA Antibody (5A7-2E11) [NBP2-12892] - Tissue: Colon cancer cell line (HT-29). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-CENP-A Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: DAPI (blue) nuclear stain at 1:5000 for 5 min RT. Localization: Nucleus. Magnification: 60X.
Species: Hu
Applications: WB, ICC/IF
DSCAM Antibody
NBP2-30716
Immunocytochemistry/Immunofluorescence: DSCAM Antibody [NBP2-30716] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DSCAM Antibody [NBP2-30716] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: DSCAM Antibody [NBP2-30716] - Staining of human cerebral cortex shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PXMP3 Antibody
NBP1-87351
Immunohistochemistry-Paraffin: PXMP3 Antibody [NBP1-87351] - Staining of human gallbladder shows cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
E-Cadherin
Antibody [Unconjugate
AF748
Western blot shows lysates of A431 human epithelial carcinoma cell line, A549 human lung carcinoma cell line, HepG2 human hepatocellular carcinoma cell line, P19 mouse embryonal carcinoma cell line, and 4T1 mouse breast cancer cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for E‑Cadherin at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of 4T1 mouse breast cancer cell line, P19 mouse embryonal carcinoma cell line, A431 human epithelial carcinoma cell line, and MCF‑7 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for E‑Cadherin at approximately 128 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
E‑Cadherin was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human/MouseE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
(5 Reviews)
(25 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
ATP5A Antibody
NBP2-15512
Western Blot: ATP5A Antibody [NBP2-15512] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with ATP5A1 antibody diluted at 1:2000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: ATP5A Antibody [NBP2-15512] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: ATP5A1 protein stained by ATP5A1 antibody [C2C3], C-term diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Frozen: ATP5A Antibody [NBP2-15512] - Frozen sectioned adult mouse retina. Green: ATP5A1 protein stained by ATP5A1 antibody [C2C3], C-term diluted at 1:250. Red: Protein kinase C alpha staining.Blue: Fluoroshield with DAPI.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Aconitase 1
Antibody
NBP1-87677
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in human cell lines U2OS and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Immunocytochemistry/Immunofluorescence: Aconitase 1 Antibody [NBP1-87677] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human tonsil shows no positivity in lymphoid cells as expected.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Spt6 Antibody
NB100-2582
Western Blot: Spt6 Antibody [NB100-2582] - siRNA knockdown to confirm the specificity of Spt6 antibody (NB100-2582) in C2C12 myoblasts, WB: 1:2000 dilution. 20ug whole cell lysate. Image from verified customer review.
Immunohistochemistry: Spt6 Antibody [NB100-2582] - Sample: FFPE sections of human breast carcinoma (left) and mouse squamous cell carcinoma (right). Antibody: Affinity purified rabbit anti- SUPT6H used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB
Western Blot: Spt6 Antibody [NB100-2582] - Detection of Human Spt6 on HeLa whole cell lysate using NB100-2582. Spt6 was also immunoprecipitated by another rabbit anti-Spt6 antibody.
(1 Review)
(5 Publications)
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP
BPTF/FALZ Antibody
NB100-41418
Western Blot: BPTF/FALZ Antibody [NB100-41418] - Detection of Human FALZ/BPTF by Western Blot. Samples: Whole cell lysate (15 and 50 ug) from HeLa cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-FALZ/BPTF antibody NB100-41418 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry: BPTF/FALZ Antibody [NB100-41418] - Samples: FFPE serial sections of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-FALZ/BPTF Cat. No. Lot1 used at a dilution of 1:250 (0.8ug/ml) (left) and Cat. No. Lot2 used at a dilution of 1:1,000 (0.2ug/ml) (right). Detection: DAB. Cou
Western Blot: BPTF/FALZ Antibody [NB100-41418] - Whole cell lysate (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded) from HeLa cells. NB100-41418 used for WB at 0.04 mcg/ml (A) and 0.1 mcg/ml (B) and used for IP at 3 mcg/mg lysate (B).
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, IP
CHD3 Antibody (2G4)
NBP1-51593
Western Blot: CHD3 Antibody (2G4) [NBP1-51593] - Western blot analysis using CHD3 mouse mAb against Hela (1), K562 (2), Jurkat (3), NTERA-2 (4), HEK293 (5), Raji (6) cell lysate and mouse brain (7) tissue lysate.
Immunocytochemistry/Immunofluorescence: CHD3 Antibody (2G4) [NBP1-51593] - Immunofluorescence analysis of Hela cells using CHD3 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry-Paraffin: CHD3 Antibody (2G4) [NBP1-51593] - Immunohistochemical analysis of paraffin-embedded colon cancer tissues using CHD3 mouse mAb with DAB staining.
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
HYPB Knockout HeLa
Cell Lysate
NBP2-65171
HYPB Knockout HeLa Cell Lysate
Species: Hu
ACF Antibody
NBP2-33412
Immunocytochemistry/Immunofluorescence: ACF Antibody [NBP2-33412] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACF Antibody [NBP2-33412] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.
Immunohistochemistry-Paraffin: ACF Antibody [NBP2-33412] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CHD1 Antibody (H00001105-M04) (0)

There are no publications for CHD1 Antibody (H00001105-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHD1 Antibody (H00001105-M04) (0)

There are no reviews for CHD1 Antibody (H00001105-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHD1 Antibody (H00001105-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

CHD1 Knockout 293T Cell Lysate

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CHD1 Antibody (H00001105-M04)

Discover related pathways, diseases and genes to CHD1 Antibody (H00001105-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHD1 Antibody (H00001105-M04)

Discover more about diseases related to CHD1 Antibody (H00001105-M04).
 

Pathways for CHD1 Antibody (H00001105-M04)

View related products by pathway.

PTMs for CHD1 Antibody (H00001105-M04)

Learn more about PTMs related to CHD1 Antibody (H00001105-M04).

Blogs on CHD1

There are no specific blogs for CHD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHD1 Antibody (1G2) and receive a gift card or discount.


Bioinformatics

Gene Symbol CHD1
Entrez
Uniprot