CHD1 Antibody (1G2)

Images

 
Immunocytochemistry/ Immunofluorescence: CHD1 Antibody (1G2) [H00001105-M04] - Analysis of monoclonal antibody to CHD1 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: CHD1 Antibody (1G2) [H00001105-M04] - Detection limit for recombinant GST tagged CHD1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1G2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CHD1 Antibody (1G2) Summary

Immunogen
CHD1 (NP_001261 1177 a.a. - 1272 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS
Specificity
Reacts with chromodomain helicase DNA binding protein 1.
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CHD1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.
Control
CHD1 Lysate (NBP2-65814)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CHD1 Antibody (1G2)

  • ATP-dependent helicase CHD1
  • CHD1
  • CHD-1
  • chromodomain helicase DNA binding protein 1
  • chromodomain-helicase-DNA-binding protein 1
  • DKFZp686E2337
  • EC 3.6.1
  • EC 3.6.4.12

Background

The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61879
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-55310
Species: Hu, Mu
Applications: WB, IP
NB600-273
Species: Hu, Mu
Applications: WB, IP
NBP2-32563
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NBP2-30716
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-15512
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP
NB100-41418
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-51593
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-65171
Species: Hu
NBP2-33412
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CHD1 Antibody (H00001105-M04) (0)

There are no publications for CHD1 Antibody (H00001105-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHD1 Antibody (H00001105-M04) (0)

There are no reviews for CHD1 Antibody (H00001105-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHD1 Antibody (H00001105-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CHD1 Antibody (H00001105-M04)

Discover related pathways, diseases and genes to CHD1 Antibody (H00001105-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHD1 Antibody (H00001105-M04)

Discover more about diseases related to CHD1 Antibody (H00001105-M04).
 

Pathways for CHD1 Antibody (H00001105-M04)

View related products by pathway.

PTMs for CHD1 Antibody (H00001105-M04)

Learn more about PTMs related to CHD1 Antibody (H00001105-M04).

Blogs on CHD1

There are no specific blogs for CHD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHD1 Antibody (1G2) and receive a gift card or discount.

Bioinformatics

Gene Symbol CHD1
Entrez
Uniprot