Home » CHD1 » CHD1 Antibodies » CHD1 Antibody (1G2)

CHD1 Antibody (1G2)

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: CHD1 Antibody (1G2) [H00001105-M04] - Analysis of monoclonal antibody to CHD1 on HeLa cell. Antibody concentration 10 ug/ml
Immunocytochemistry/ Immunofluorescence: CHD1 Antibody (1G2) [H00001105-M04] - Analysis of monoclonal antibody to CHD1 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: CHD1 Antibody (1G2) [H00001105-M04] - Detection limit for recombinant GST tagged CHD1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
1G2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CHD1 Antibody (1G2) Summary

Immunogen
CHD1 (NP_001261, 1177 a.a. ~ 1272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS
Specificity
Reacts with chromodomain helicase DNA binding protein 1.
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CHD1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CHD1 Antibody (1G2)

  • ATP-dependent helicase CHD1
  • CHD1
  • CHD-1
  • chromodomain helicase DNA binding protein 1
  • chromodomain-helicase-DNA-binding protein 1
  • DKFZp686E2337
  • EC 3.6.1
  • EC 3.6.4.12

Background

The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SMARCA1 Antibody
(2H7B8) - BSA Free
NBP2-61879
ELISA: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Black line: Control Antigen (100 ng);Purple line: Antigen (10ng); Blue line: Antigen (50 ng); Red line:Antigen (100 ng)
Flow Cytometry: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis of NIH/3T3 cells using SMARCA1 mouse mAb (green) and negative control (red).
Immunohistochemistry: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis of paraffin-embedded esophageal cancer tissues using SMARCA1 mouse mAb with DAB staining.
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
Histone H3
[Trimethyl Lys9] Anti ...
NBP1-30141
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Representative Western blot showing M-track protein protein proximity signals obtained for Kic1. Hog1-protA-H3: background control, Nup2: positive control. Below: Proximity signals. n = 3 replicates per sample except when indicated differently. Ratios are log2-transformed. Black lines indicate average proximity signal. Proximity signals that differ significantly from background are marked in green (q 0.01) filled circles. Grey filled triangles: q > 0.05. N: N-terminal HKMTmyc fusion. Image collected and cropped by CiteAb from the following publication (https://biosignaling.biomedcentral.com/articles/10.1186/s12964-019-0381-z), licensed under a CC-BY licence.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Analysis of Histone H3 K9-me3 in HeLa histone lysates. Observed molecular weight is ~15 kDa.
(2 Reviews)
(24 Publications)
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Brg1 Antibody
[Unconjugated]
AF5738
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and K562 human chronic myelogenous leukemia cell line, cytoplasmic and nuclear extracts. PVDF membrane was probed with 2 µg/mL Goat Anti-Human Brg1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5738) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band for Brg1 was detected at approximately 205 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Brg1 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Goat Anti-Human Brg1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5738) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Brg1 was detected in immersion fixed undifferentiated rat cortical stem cells using Goat Anti-Human Brg1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5738) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
Species: Hu
Applications: ICC, KO, WB
BRM Antibody
NBP3-13283
Immunohistochemistry-Paraffin: BRM Antibody [NBP3-13283] - BRM antibody detects BRM protein at nucleus in mouse brain by immunohistochemical analysis. Sample: Paraffin-embedded mouse brain. BRM antibody (NBP3-13283) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunohistochemistry-Paraffin: BRM Antibody [NBP3-13283] - BRM antibody detects BRM protein at nucleus in mouse testis by immunohistochemical analysis. Sample: Paraffin-embedded mouse testis. BRM antibody (NBP3-13283) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunocytochemistry/Immunofluorescence: BRM Antibody [NBP3-13283] - BRM antibody detects BRM protein at nucleus by immunofluorescent analysis. Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: BRM stained by BRM antibody (NBP3-13283) diluted at 1:500. Red: phalloidin, a cytoskeleton marker, diluted at 1:200. Scale bar= 10 um.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SMARCA5/SNF2H
Antibody
NB100-55310
Western Blot: SMARCA5/SNF2H Antibody [NB100-55310] - WB analysis of SNF2H in Mouse Stem Cell lysate. Verified customer review from 1DegreeBio.
Western Blot: SMARCA5/SNF2H Antibody [NB100-55310] - SNF2H Antibody [NB100-55310] - Detection of Human SNF2h/ISWI on HeLa whole cell lysate using NB100-55310. SNF2h/ISWI was also immunoprecipitated by rabbit anti-SNF2h/ISWI antibodies BL4495 and NB100-55311.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: IP, WB
PAF1 Antibody
NB600-273
Western Blot: PAF1 Antibody [NB600-273] - Whole cell lysate (15 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit antiPaf1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: PAF1 Antibody [NB600-273] - Detection of human Paf1 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-Paf1 antibody NB600-273 used for IP at 3 ug per reaction. Paf1 was also immunoprecipitated by rabbit anti-Paf1 antibody NB600-274. For blotting immunoprecipitated Paf1, NB600-273 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
(5 Publications)
Species: Hu, Mu
Applications: IP, WB
CHD2 Antibody
NBP2-32563
Immunocytochemistry/Immunofluorescence: CHD2 Antibody [NBP2-32563] - Immunofluorescent staining of human cell line SiHa shows localization to nucleus & vesicles.
Immunohistochemistry-Paraffin: CHD2 Antibody [NBP2-32563] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: CHD2 Antibody [NBP2-32563] - Staining of human thyroid gland shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CENPA Antibody
NBP2-92632
Immunocytochemistry/Immunofluorescence: CENPA Antibody [NBP2-92632] - Analysis of U-2 OS cells using CENPA . Blue: DAPI for nuclear staining.
Western Blot: CENPA Antibody [NBP2-92632] - Analysis of extracts of various cell lines, using CENPA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 180s.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DSCAM Antibody
[Unconjugated] - Long ...
AF3666
Western blot shows 25 ng of Recombinant Human DSCAM (Catalog # 3666-DS) and Recombinant Human DSCAM‑L1 (Catalog # 3315-DL). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human DSCAM Long Isoform Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3666) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for DSCAM at approximately 250 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
DSCAM was detected in immersion fixed A172 human glioblastoma cell line using 10 µg/mL Goat Anti-Human DSCAM Long Isoform Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3666) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(4 Publications)
Species: Hu
Applications: ICC, WB
PXMP3 Antibody
NBP2-94643
Western Blot: PXMP3 Antibody [NBP2-94643] - Analysis of extracts of various cell lines, using PXMP3 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 20s.
Immunohistochemistry-Paraffin: PXMP3 Antibody [NBP2-94643] - Immunohistochemistry of paraffin-embedded human placenta using PXMP3 Rabbit pAb (NBP2-94643) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
E-Cadherin
Antibody [Unconjugate
AF748
E‑Cadherin was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human/MouseE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
E‑Cadherin was detected in perfusion fixed frozen sections of mouse skin using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membranes in keratinocytes. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
E‑Cadherin was detected in immersion fixed mouse intestinal organoids using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (green; Catalog # NL001) and counterstained with DAPI (blue). Magnification shown at 100X (upper panel) and 40X (lower panel). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(56 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Aconitase 1
Antibody
NBP1-87677
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining in human kidney and tonsil tissues.. Corresponding ACO1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
(2 Reviews)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Spt6 Antibody
NB100-2582
Western Blot: Spt6 Antibody [NB100-2582] - siRNA knockdown to confirm the specificity of Spt6 antibody (NB100-2582) in C2C12 myoblasts, WB: 1:2000 dilution. 20 ug whole cell lysate. WB image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Spt6 Antibody [NB100-2582] - Sections of human breast carcinoma (left) and mouse squamous cell carcinoma (right). Antibody: Affinity purified rabbit anti- SUPT6H used at a dilution of 1:1,000 (0.2 ug/mL). Detection: DAB
Western Blot: Spt6 Antibody [NB100-2582] - Detection of Human Spt6 on HeLa whole cell lysate using NB100-2582. Spt6 was also immunoprecipitated by another rabbit anti-Spt6 antibody.
(2 Reviews)
(16 Publications)
Species: Ch, Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, KD, WB
BPTF/FALZ Antibody
NB100-41418
Western Blot: BPTF/FALZ Antibody [NB100-41418] - Detection of Human FALZ/BPTF by Western Blot. Samples: Whole cell lysate (15 and 50 ug) from HeLa cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-FALZ/BPTF antibody NB100-41418 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunoprecipitation: BPTF/FALZ Antibody [NB100-41418] - Detection of human FALZ/BPTF by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-FALZ/BPTF antibody NB100-41418 used for IP at 6 ug per reaction. For blotting immunoprecipitated FALZ/BPTF, NB100-41418 was used at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry-Paraffin: BPTF/FALZ Antibody [NB100-41418] - Section of human lung carcinoma. Antibody: Affinity purified rabbit antiFALZ/BPTF used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
CHD3 Antibody
(8Z6L6)
NBP3-16632
Immunohistochemistry-Paraffin: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry of paraffin-embedded rat spleen using CHD3 Rabbit mAb (NBP3-16632) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry of paraffin-embedded human appendix using CHD3 Rabbit mAb (NBP3-16632) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry of paraffin-embedded mouse brain using CHD3 Rabbit mAb (NBP3-16632) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HYPB Antibody
(CL9956)
NBP2-88941
Immunohistochemistry-Paraffin: HYPB Antibody (CL9956) [NBP2-88941] - Staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: HYPB Antibody (CL9956) [NBP2-88941] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: HYPB Antibody (CL9956) [NBP2-88941] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.
Species: Hu
Applications: IHC, IHC-P
ACF Antibody
NBP1-90271
Western Blot: ACF Antibody [NBP1-90271] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ACF Antibody [NBP1-90271] - Staining of human colon, kidney, liver and tonsil using Anti-A1CF antibody NBP1-90271 (A) shows similar protein distribution across tissues to independent antibody NBP2-33412 (B).
Immunohistochemistry-Paraffin: ACF Antibody [NBP1-90271] - Staining of human tonsil shows no positivity as expected.
Species: Hu
Applications: IHC, IHC-P, WB
CHD1 Antibody (1G2)
H00001105-M04
CHD1 Antibody (1G2)
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for CHD1 Antibody (H00001105-M04) (0)

There are no publications for CHD1 Antibody (H00001105-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHD1 Antibody (H00001105-M04) (0)

There are no reviews for CHD1 Antibody (H00001105-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHD1 Antibody (H00001105-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHD1 Products

Array H00001105-M04

Bioinformatics Tool for CHD1 Antibody (H00001105-M04)

Discover related pathways, diseases and genes to CHD1 Antibody (H00001105-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHD1 Antibody (H00001105-M04)

Discover more about diseases related to CHD1 Antibody (H00001105-M04).
 

Pathways for CHD1 Antibody (H00001105-M04)

View related products by pathway.

PTMs for CHD1 Antibody (H00001105-M04)

Learn more about PTMs related to CHD1 Antibody (H00001105-M04).
 

Research Areas for CHD1 Antibody (H00001105-M04)

Find related products by research area.

Blogs on CHD1

There are no specific blogs for CHD1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHD1 Antibody (1G2) and receive a gift card or discount.


Bioinformatics

Gene Symbol CHD1
Entrez
Uniprot