CHD1 Antibody (1G2) Summary
Immunogen |
CHD1 (NP_001261, 1177 a.a. ~ 1272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS |
Specificity |
Reacts with chromodomain helicase DNA binding protein 1. |
Isotype |
IgG2b Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
CHD1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/Immunofluorescence
- Sandwich ELISA
- Western Blot
|
Application Notes |
This antibody is reactive against recombinant protein in WB and ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CHD1 Antibody (1G2)
Background
The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Publications for CHD1 Antibody (H00001105-M04) (0)
There are no publications for CHD1 Antibody (H00001105-M04).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CHD1 Antibody (H00001105-M04) (0)
There are no reviews for CHD1 Antibody (H00001105-M04).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CHD1 Antibody (H00001105-M04) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CHD1 Products
Bioinformatics Tool for CHD1 Antibody (H00001105-M04)
Discover related pathways, diseases and genes to CHD1 Antibody (H00001105-M04). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for CHD1 Antibody (H00001105-M04)
Discover more about diseases related to CHD1 Antibody (H00001105-M04).
| | Pathways for CHD1 Antibody (H00001105-M04)
View related products by pathway.
|
PTMs for CHD1 Antibody (H00001105-M04)
Learn more about PTMs related to CHD1 Antibody (H00001105-M04).
| | Research Areas for CHD1 Antibody (H00001105-M04)
Find related products by research area.
|
Blogs on CHD1