CHD1 Antibody (1G2) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: CHD1 Antibody (1G2) [H00001105-M04] - Analysis of monoclonal antibody to CHD1 on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: CHD1 Antibody (1G2) [H00001105-M04] - Detection limit for recombinant GST tagged CHD1 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1G2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CHD1 Antibody (1G2) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CHD1 (NP_001261, 1177 a.a. ~ 1272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS
• Specificity: Reacts with chromodomain helicase DNA binding protein 1.
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CHD1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CHD1 Antibody (1G2) - Azide and BSA Free

• ATP-dependent helicase CHD1
• CHD1
• CHD-1
• chromodomain helicase DNA binding protein 1
• chromodomain-helicase-DNA-binding protein 1
• DKFZp686E2337
• EC 3.6.1
• EC 3.6.4.12

Background

The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHD1
• Entrez:
  • 1105(Human)
• Uniprot:
  • NP_001261(Human)