CH25H Antibody (1G8)

Images

 
There are currently no images for CH25H Antibody (H00009023-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CH25H Antibody (1G8) Summary

Immunogen
CH25H (AAH17843.1 142 a.a. - 247 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFN
Specificity
CH25H - cholesterol 25-hydroxylase (1G8)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CH25H
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CH25H Antibody (1G8)

  • C25H
  • cholesterol 25-hydroxylase
  • Cholesterol 25-monooxygenase
  • EC 1.14.99.38
  • h25OH

Background

This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-32433
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-140
Species: Hu, Rb, Mu(-)
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27352
Species: Hu
Applications: WB, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
H00009420-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF5699
Species: Hu, Mu
Applications: WB, IHC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-85816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
H00009023-M01
Species: Hu
Applications: WB, ELISA

Publications for CH25H Antibody (H00009023-M01) (0)

There are no publications for CH25H Antibody (H00009023-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CH25H Antibody (H00009023-M01) (0)

There are no reviews for CH25H Antibody (H00009023-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CH25H Antibody (H00009023-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CH25H Products

Bioinformatics Tool for CH25H Antibody (H00009023-M01)

Discover related pathways, diseases and genes to CH25H Antibody (H00009023-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CH25H Antibody (H00009023-M01)

Discover more about diseases related to CH25H Antibody (H00009023-M01).
 

Pathways for CH25H Antibody (H00009023-M01)

View related products by pathway.

PTMs for CH25H Antibody (H00009023-M01)

Learn more about PTMs related to CH25H Antibody (H00009023-M01).

Blogs on CH25H

There are no specific blogs for CH25H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CH25H Antibody (1G8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CH25H
Entrez
Uniprot