CGR19 Antibody - BSA Free

Analysis in human cell line U-2 OS.

Staining of human skin shows very weak positivity in squamous epithelial cells as expected.

Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Staining of human cell line U-251 MG shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CGR19 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CGR19 Antibody - BSA Free (NBP1-85644) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CGR19 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IYDIISMVSVIHIPDRTYKLSCRILYQYLLLAQGQFHDLKQLFMSANNNFTPSNNSSSEEKNTDRSLLEKVGLSESEVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALCSQKEQDKDKPK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CGRRF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CGR19 Protein (NBP1-85644PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CGR19 Antibody - BSA Free

• cell growth regulator with ring finger domain 1
• Cell growth regulatory gene 19 protein
• CGR19cell growth regulator with RING finger domain protein 1
• RING finger protein 197
• RNF197GCRRF1

Background

CGR19 is a gene that codes for a protein that is able to inhibit growth in certain cell lines, which is 332 amino acids long and weighs approximately 38 kDa. CGR19 has been shown to have interactions with UBE2U, CREB3, PEX10, and UBC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CGR19 Antibody (NBP1-85644)(1)

Publication using NBP1-85644

• Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012-04-03 [PMID: 22361696]

Bioinformatics

• Gene Symbol: CGRRF1