CGNL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CGNL1 Antibody [NBP2-56274] - Staining of human cell line CACO-2 shows localization to cell junctions.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CGNL1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NRATATSPDSGAKKISVKTFPSASNTQATPDLLKGQQELTQQTNEETAKQILYNYLKEGSTDNDDATKRKVNLVFEKIQTLKSRAAGSAQGNNQACNSTSEVKDLLEQKSKLT
Specificity
Specificity of human CGNL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CGNL1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 85%, Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CGNL1 Antibody

  • Cingulin-Like 1
  • Cingulin-Like Protein 1
  • FLJ14957
  • JACOP
  • Junction-Associated Coiled-Coil Protein
  • KIAA1749
  • paracingulin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP2-67091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89600
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89600
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76328
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-02500
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86632
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90625
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58359
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
NBP2-75096
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP2-38696
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88827
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CGNL1 Antibody (NBP2-56274) (0)

There are no publications for CGNL1 Antibody (NBP2-56274).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CGNL1 Antibody (NBP2-56274) (0)

There are no reviews for CGNL1 Antibody (NBP2-56274). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CGNL1 Antibody (NBP2-56274) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CGNL1 Products

Array NBP2-56274

Bioinformatics Tool for CGNL1 Antibody (NBP2-56274)

Discover related pathways, diseases and genes to CGNL1 Antibody (NBP2-56274). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CGNL1 Antibody (NBP2-56274)

Discover more about diseases related to CGNL1 Antibody (NBP2-56274).
 

Pathways for CGNL1 Antibody (NBP2-56274)

View related products by pathway.

Blogs on CGNL1

There are no specific blogs for CGNL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CGNL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CGNL1