cGK1/PRKG1 Antibody (5E5)

Images

 
Western Blot: cGK1/PRKG1 Antibody (5E5) [H00005592-M01] - Analysis of PRKG1 expression in transfected 293T cell line by PRKG1 monoclonal antibody (M01), clone 5E5.Lane 1: PRKG1 transfected lysate(35.5 KDa).Lane 2: ...read more
Sandwich ELISA: cGK1/PRKG1 Antibody (5E5) [H00005592-M01] - Detection limit for recombinant GST tagged PRKG1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5E5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

cGK1/PRKG1 Antibody (5E5) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
PRKG1 (NP_006249, 73 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGV
Specificity
PRKG1 - protein kinase, cGMP-dependent, type I
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRKG1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for cGK1/PRKG1 Antibody (5E5)

  • AAT8
  • cGK 1
  • cGK
  • cGK1
  • cGK1/PRKG1
  • cGKI
  • cGKI-alpha
  • cGKI-BETA
  • cGMP-dependent protein kinase I
  • DKFZp686K042
  • EC 2.7.11
  • EC 2.7.11.12
  • FLJ36117
  • PKG
  • PKG1
  • PRKG1
  • PRKG1B
  • PRKG1BMGC71944
  • PRKGR1A
  • PRKGR1B
  • PRKGR1BcGMP-dependent, regulatory, type I, beta
  • protein kinase cGMP-dependent 1
  • protein kinase, cGMP-dependent, type I

Background

cGK1/PRKG1, also known as cGMP-dependent protein kinase 1, has two isoforms that are produced by alternative splicing. Isoform Alpha (CGK1-alpha) is 671 amino acids long and 76 kDa. Isoform Beta (CGK1-beta) is 686 amino acids long and approximately 78 kDa. PRKG1 is a Serine/threonine protein kinase that is expressed in placenta and lung. cGK1/PRKG1 is an important player in the Nitric Oxide/cGMP Signaling Pathway; the binding of GMP activates PRKG1, which in turn phosphorylates Serine residues and Threonine residues on various cell proteins, including proteins that regulate calcium levels, smooth muscle contraction, platelet adhesion, circadian rhythm and more. Current research on PRKG1 is being conducted in relation to several diseases and disorders including cystic fibrosis, lymphoma, non-small cell lung carcinoma, Wiskott-Aldrich syndrome, Waterhouse-Friderichsen syndrome and myoglobinuria. PRKG1 has also been shown to have interactions with SMAD4, BMPR2, GKAP1, Natriuretic Peptide Receptor A and TFII-I in pathways such as Gap Junction signaling, eNOS signaling and EDNRB signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for cGK1/PRKG1 Antibody (H00005592-M01) (0)

There are no publications for cGK1/PRKG1 Antibody (H00005592-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for cGK1/PRKG1 Antibody (H00005592-M01) (0)

There are no reviews for cGK1/PRKG1 Antibody (H00005592-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for cGK1/PRKG1 Antibody (H00005592-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional cGK1/PRKG1 Products

Research Areas for cGK1/PRKG1 Antibody (H00005592-M01)

Find related products by research area.

Blogs on cGK1/PRKG1

There are no specific blogs for cGK1/PRKG1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our cGK1/PRKG1 Antibody (5E5) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKG1
Entrez
OMIM
Uniprot