cGK1/PRKG1 Antibody (2B3)

Images

 
Immunohistochemistry-Paraffin: cGK1/PRKG1 Antibody (2B3) [H00005592-M03] - Analysis of monoclonal antibody to PRKG1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml
ELISA: cGK1/PRKG1 Antibody (2B3) [H00005592-M03] - Detection limit for recombinant GST tagged PRKG1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

cGK1/PRKG1 Antibody (2B3) Summary

Immunogen
PRKG1 (NP_006249 73 a.a. - 170 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGV
Specificity
protein kinase, cGMP-dependent, type I
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRKG1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for cGK1/PRKG1 Antibody (2B3)

  • cGKI
  • cGMP-dependent protein kinase I
  • DKFZp686K042
  • EC 2.7.11
  • EC 2.7.11.12
  • FLJ36117
  • PRKG1BMGC71944
  • PRKGR1A
  • PRKGR1BcGMP-dependent, regulatory, type I, beta
  • protein kinase, cGMP-dependent, type I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84497
Species: Hu
Applications: IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for cGK1/PRKG1 Antibody (H00005592-M03) (0)

There are no publications for cGK1/PRKG1 Antibody (H00005592-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for cGK1/PRKG1 Antibody (H00005592-M03) (0)

There are no reviews for cGK1/PRKG1 Antibody (H00005592-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for cGK1/PRKG1 Antibody (H00005592-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional cGK1/PRKG1 Products

Bioinformatics Tool for cGK1/PRKG1 Antibody (H00005592-M03)

Discover related pathways, diseases and genes to cGK1/PRKG1 Antibody (H00005592-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for cGK1/PRKG1 Antibody (H00005592-M03)

Discover more about diseases related to cGK1/PRKG1 Antibody (H00005592-M03).
 

Pathways for cGK1/PRKG1 Antibody (H00005592-M03)

View related products by pathway.

PTMs for cGK1/PRKG1 Antibody (H00005592-M03)

Learn more about PTMs related to cGK1/PRKG1 Antibody (H00005592-M03).
 

Research Areas for cGK1/PRKG1 Antibody (H00005592-M03)

Find related products by research area.

Blogs on cGK1/PRKG1

There are no specific blogs for cGK1/PRKG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our cGK1/PRKG1 Antibody (2B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKG1
Entrez
OMIM
Uniprot