CGI-16 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CGI-16 Antibody [NBP1-90275] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & cytosol.

Immunohistochemistry-Paraffin: CGI-16 Antibody [NBP1-90275] - Staining of human bronchus shows strong granular cytoplasmic positivity in respiratory epithelial cells.

Analysis in human cell line RH-30.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CGI-16 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CGI-16 Antibody - BSA Free (NBP1-90275) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRVLPSNAVWME
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACOT9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CGI-16 Protein (NBP1-90275PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CGI-16 Antibody - BSA Free

• ACATE2
• Acyl-CoA thioester hydrolase 9
• acyl-CoA thioesterase 9acyl-Coenzyme A thioesterase 2, mitochondrial
• acyl-coenzyme A thioesterase 9, mitochondrial
• CGI-16
• EC 3.1.2
• EC 3.1.2.-
• EC 3.1.2.15
• mitochondrial Acyl-CoA Thioesterase
• MT-ACT48

Background

Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fattyacid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Active on long chain acyl-CoAs

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACOT9