Recombinant Human CGB5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CGB5 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 165 of Human CGB5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ

Protein/Peptide Type
Recombinant Protein
Gene
CGB5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CGB5 Protein

  • CGB3
  • CG-beta
  • Chorionic gonadotrophin chain beta
  • chorionic gonadotropin beta 5 subunit
  • chorionic gonadotropin, beta polypeptide 5
  • HCG
  • MGC119822

Background

This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 5 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-83910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-22444
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IF
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA

Publications for CGB5 Recombinant Protein (H00093659-P02) (0)

There are no publications for CGB5 Recombinant Protein (H00093659-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CGB5 Recombinant Protein (H00093659-P02) (0)

There are no reviews for CGB5 Recombinant Protein (H00093659-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CGB5 Recombinant Protein (H00093659-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CGB5 Products

Bioinformatics Tool for CGB5 Recombinant Protein (H00093659-P02)

Discover related pathways, diseases and genes to CGB5 Recombinant Protein (H00093659-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CGB5 Recombinant Protein (H00093659-P02)

Discover more about diseases related to CGB5 Recombinant Protein (H00093659-P02).
 

Pathways for CGB5 Recombinant Protein (H00093659-P02)

View related products by pathway.

PTMs for CGB5 Recombinant Protein (H00093659-P02)

Learn more about PTMs related to CGB5 Recombinant Protein (H00093659-P02).
 

Research Areas for CGB5 Recombinant Protein (H00093659-P02)

Find related products by research area.

Blogs on CGB5

There are no specific blogs for CGB5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CGB5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CGB5