Simple Western: cGAS Antibody [NBP1-86761] - Simple Western lane view shows a specific band for MB21D1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more
Simple Western: cGAS Antibody [NBP1-86761] - Electropherogram image(s) of corresponding Simple Western lane view. MB21D1 antibody was used at 1:30 dilution on RT-4 lysate(s).
Analysis in human cell line CACO-2 and human cell line HEK 293.
This antibody was developed against Recombinant Protein corresponding to amino acids: RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CGAS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunocytochemistry/ Immunofluorescence Reactivity reported in scientific literature (PMID: 24970844]
Immunohistochemistry Reactivity reported in scientific literature (PMID: 35099823)
Simple Western 1:30
Western Blot 0.04 - 0.4 ug/mL
Application Notes
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:30, apparent MW was 65 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for cGAS Antibody - BSA Free
C6orf150
c-GAS
cyclic GMP-AMP synthase
h-cGAS
Mab-21 domain containing 1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Name: Anti-cGAS antibody (NBP1-86761) Catalog #: Anti-cGAS antibody (NBP1-86761) Lot Number: Anti-cGAS antibody (NBP1-86761, Lot # G105753) PO/Order Number: Click here to enter text.. WB Image Description (Please provide labels for all lanes): lane 1: human primary hepatocytes; lane 2: Hep G2 Sample Information: Cell Line or Tissue: human primary hepatocytes, Hep G2 Species: human Treatment: No Lysate Preparation: Date of lysate preparation: December 7, 2017 Lysis buffer used: 1X lysis buffer from Cell Signaling by adding PMSF Reducing agent: beta-mercaptoethanol, DTT If boiled (temperature/time): Yes Controls: Positive Control: No Negative Control: No Loading Control (please attach additional images if applicable): No Protein Amount Loaded per lane: 20 ug Antibody Storage Conditions: -20℃ Electrophoresis: Gel Percentage: 10% Electrophoresis Conditions: Tris-Glycine-SDS at room temperature Voltage: 120V Time: 2 hours Membrane Transfer: Method (Submersion/Semi-dry): wet transfer Membrane Type (PVDF/Nitrocellulose): Nitrocellulose Time: 2 hours Voltage: 100V Blocking: Blocking Solution: 5% milk in 1X TBST Time: 1 hour at room temperature Primary Antibody: Dilution: 1/500 Diluent Buffer: 2.5% BSA Incubation Time: overnight Incubation Temperature: 4℃ Washing Conditions: Wash Solution: 1X TBST Time and Repetitions: 5 min each for 3 times Secondary Antibody Manufacturer and Catalog #: Promega, cat # W401B, Lot # 0000187662 Secondary description: goat anti-rabbit secondary antibody Dilution: 1/2000 Diluent Buffer: 3% milk Incubation Time: 1 hour Incubation Temperature: room temperature Detection Method: Detection: ECL (GE, cat # RPN2209, lot #n9838243) Procedure: Add equal volume of A and B, mix and apply on the membranes for 3-5 min before exposure Development Time: 3 min Molecular weight of band(s): ~55 kDa Experimental Concerns and Observations: Specific bands around 55 kDa were observed
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.