CEP120 Antibody

Images

 
Immunohistochemistry: CEP120 Antibody [NBP2-49011] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEP120 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SKSDQLLIVVSILEGRHFPKRPKHMLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKALHQHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKSEIQISIALETDTKPPVD
Specificity
Specificity of human CEP120 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEP120
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEP120 Antibody

  • CCDC100
  • centrosomal protein 120kDa
  • centrosomal protein of 120 kDa
  • coiled-coil domain containing 100
  • coiled-coil domain-containing protein 100
  • DKFZp686I06246
  • FLJ36090

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87196
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00057154-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
7954-GM/CF
Species: Hu
NBP2-58397
Species: Hu
Applications: WB, ICC/IF
NBP2-16109
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IHC, IHC-P, ISH
NBP1-82865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-33814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IHC-Fr, IP
NBP1-80773
Species: Hu
Applications: IHC, IHC-P
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-92438
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37986
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56038
Species: Hu
Applications: ICC/IF
NBP1-81260
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14088
Species: Hu
Applications: IHC, IHC-P
NBP1-87456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03381
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CEP120 Antibody (NBP2-49011) (0)

There are no publications for CEP120 Antibody (NBP2-49011).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEP120 Antibody (NBP2-49011) (0)

There are no reviews for CEP120 Antibody (NBP2-49011). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CEP120 Antibody (NBP2-49011) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CEP120 Products

Array NBP2-49011

Bioinformatics Tool for CEP120 Antibody (NBP2-49011)

Discover related pathways, diseases and genes to CEP120 Antibody (NBP2-49011). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEP120 Antibody (NBP2-49011)

Discover more about diseases related to CEP120 Antibody (NBP2-49011).
 

Pathways for CEP120 Antibody (NBP2-49011)

View related products by pathway.

Blogs on CEP120

There are no specific blogs for CEP120, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEP120 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEP120