DTW Domain Containing 2 Antibody

Images

 
Western Blot: DTW Domain Containing 2 Antibody [NBP2-58397] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: DTW Domain Containing 2 Antibody [NBP2-58397] - Staining of human cell line A-431 shows localization to nuclear bodies.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DTW Domain Containing 2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EARTLQEPVARPSGASSSQTPNDKERREGGAVPAAAALGAEADDDSADGLWELPVEPAERRPECTRCSRPQKVCLCPFLPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DTWD2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DTW Domain Containing 2 Recombinant Protein Antigen (NBP2-58397PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DTW Domain Containing 2 Antibody

  • DTW Domain-Containing Protein 2
  • DTWD2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30788
Species: Hu
Applications: IHC, IHC-P
NBP2-01671
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-49011
Species: Hu
Applications: IHC
NBP2-37986
Species: Hu
Applications: ICC/IF, IHC, IHC-P
7954-GM/CF
Species: Hu
AF3364
Species: Hu
Applications: WB, ICC
NBP2-56038
Species: Hu
Applications: ICC/IF
NBP1-81260
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57176
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-90998
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16109
Species: Hu, Mu, Ze
Applications: WB, IHC, IHC-P
MAB4696
Species: Hu, Rt
Applications: WB, IHC
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80773
Species: Hu
Applications: IHC, IHC-P
NBP1-89425
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00055907-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for DTW Domain Containing 2 Antibody (NBP2-58397) (0)

There are no publications for DTW Domain Containing 2 Antibody (NBP2-58397).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DTW Domain Containing 2 Antibody (NBP2-58397) (0)

There are no reviews for DTW Domain Containing 2 Antibody (NBP2-58397). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DTW Domain Containing 2 Antibody (NBP2-58397) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DTW Domain Containing 2 Products

Bioinformatics Tool for DTW Domain Containing 2 Antibody (NBP2-58397)

Discover related pathways, diseases and genes to DTW Domain Containing 2 Antibody (NBP2-58397). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DTW Domain Containing 2 Antibody (NBP2-58397)

Discover more about diseases related to DTW Domain Containing 2 Antibody (NBP2-58397).

Blogs on DTW Domain Containing 2

There are no specific blogs for DTW Domain Containing 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DTW Domain Containing 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DTWD2