CEMIP/KIAA1199 Antibody (3C12) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse CEMIP/KIAA1199 Antibody (3C12) - Azide and BSA Free (H00057214-M01) is a monoclonal antibody validated for use in WB, ELISA and IP. Anti-CEMIP/KIAA1199 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
KIAA1199 (NP_061159.1, 880 a.a. ~ 979 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LYDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNW |
| Specificity |
KIAA1199 - KIAA1199 (3C12) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
CEMIP |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoprecipitation
- Western Blot 1:500
|
| Application Notes |
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CEMIP/KIAA1199 Antibody (3C12) - Azide and BSA Free
Background
KIAA1199 may be involved in hearing
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Bv, Gt, Hu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Po
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: WB, ELISA, IP
Publications for CEMIP/KIAA1199 Antibody (H00057214-M01)(3)
Showing Publications 1 -
3 of 3.
| Publications using H00057214-M01 |
Applications |
Species |
| W Zhang, G Yin, H Zhao, H Ling, Z Xie, C Xiao, Y Chen, Y Lin, T Jiang, S Jin, J Wang, X Yang Secreted KIAA1199 promotes the progression of rheumatoid arthritis by mediating hyaluronic acid degradation in an ANXA1-dependent manner Cell Death & Disease, 2021-01-20;12(1):102. 2021-01-20 [PMID: 33473125] |
|
|
| Wang L, Yu T, Li W et al. The miR-29c-KIAA1199 axis regulates gastric cancer migration by binding with WBP11 and PTP4A3. Oncogene. 2019-05-09 [PMID: 30626935] |
|
|
| Yang X, Qiu PC, Chen BB et al. KIAA1199 as a potential diagnostic biomarker of rheumatoid arthritis related to angiogenesis. Arthritis Research & Therapy. 2015-01-01 [PMID: 26022278] |
|
|
Reviews for CEMIP/KIAA1199 Antibody (H00057214-M01) (0)
There are no reviews for CEMIP/KIAA1199 Antibody (H00057214-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CEMIP/KIAA1199 Antibody (H00057214-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CEMIP/KIAA1199 Products
Research Areas for CEMIP/KIAA1199 Antibody (H00057214-M01)
Find related products by research area.
|
Blogs on CEMIP/KIAA1199