CELSR2 Antibody


Immunohistochemistry: CELSR2 Antibody [NBP1-85712] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

CELSR2 Antibody Summary

Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CELSR2 Protein (NBP1-85712PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CELSR2 Antibody

  • cadherin EGF LAG seven-pass G-type receptor 2
  • Cadherin family member 10
  • cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila)
  • CDHF10
  • CDHF10FLJ34118
  • CELSR2
  • EGFL2
  • EGFL2FLJ45143
  • EGF-like protein 2
  • EGF-like-domain, multiple 2
  • epidermal growth factor-like 2
  • Epidermal growth factor-like protein 2
  • Flamingo homolog 3
  • Flamingo1
  • FLJ45845
  • KIAA0279FLJ42737
  • MEGF3
  • MEGF3cadherin, EGF LAG seven-pass G-type receptor 2, flamingo (Drosophila) homolog
  • Multiple EGF-like domains protein 3
  • multiple epidermal growth factor-like domains 3
  • Multiple epidermal growth factor-like domains protein 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB
Species: Hu
Applications: IHC
Species: Mu
Applications: WB, Simple Western, IHC, Block
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
Species: Hu, Mu
Applications: Flow, IHC, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
Species: Hu
Applications: WB, IP, ICC
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for CELSR2 Antibody (NBP1-85712) (0)

There are no publications for CELSR2 Antibody (NBP1-85712).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CELSR2 Antibody (NBP1-85712) (0)

There are no reviews for CELSR2 Antibody (NBP1-85712). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CELSR2 Antibody (NBP1-85712). (Showing 1 - 1 of 1 FAQ).

  1. Can I please know the immunogenic sequences on this antibody ? I know its on the N-Terminal but I need to know the exact immunogenic sequences please. Further more, I am looking for the blocking peptide of this antibody, do you have any? Thank you
    • H00001952-Q01 is actually a partial recombinant protein whose sequence is as follows: SPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS. We do have three antibodies for this target, catalog numbers NLS1942, NLS1943 and NBP1-85712, which can be viewed on our website. The immunizing sequences for these antibodies are proprietary and cannot be disclosed. If there is a specific region that you are interested in, I would be happy to see whether these antibodies will target that area or not.

Secondary Antibodies


Isotype Controls

Additional CELSR2 Products

Bioinformatics Tool for CELSR2 Antibody (NBP1-85712)

Discover related pathways, diseases and genes to CELSR2 Antibody (NBP1-85712). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CELSR2 Antibody (NBP1-85712)

Discover more about diseases related to CELSR2 Antibody (NBP1-85712).

Pathways for CELSR2 Antibody (NBP1-85712)

View related products by pathway.

PTMs for CELSR2 Antibody (NBP1-85712)

Learn more about PTMs related to CELSR2 Antibody (NBP1-85712).

Research Areas for CELSR2 Antibody (NBP1-85712)

Find related products by research area.

Blogs on CELSR2

There are no specific blogs for CELSR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CELSR2 Antibody and receive a gift card or discount.


Gene Symbol CELSR2