CEECAM1 Antibody

Images

 
Immunohistochemistry-Paraffin: CEECAM1 Antibody [NBP1-84551] - Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEECAM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TFLASLRAEGADQLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGLEDERVNFIHLILEALVDG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CERCAM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CEECAM1 Protein (NBP1-84551PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEECAM1 Antibody

  • CEECAM1
  • CerCAM
  • cerebral endothelial cell adhesion molecule 1
  • cerebral endothelial cell adhesion moleculeMGC149621
  • GLT25D3cerebral cell adhesion molecule
  • glycosyltransferase 25 domain containing 3
  • glycosyltransferase 25 family member 3
  • KIAA1502
  • MGC149620

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14619
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90712
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-16703
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF761
Species: Mu
Applications: WB, Simple Western, Flow, IHC, AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP1-88784
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-22568
Species: Hu
Applications: IHC-P
796-IC
Species: Mu

Publications for CEECAM1 Antibody (NBP1-84551) (0)

There are no publications for CEECAM1 Antibody (NBP1-84551).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEECAM1 Antibody (NBP1-84551) (0)

There are no reviews for CEECAM1 Antibody (NBP1-84551). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CEECAM1 Antibody (NBP1-84551) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEECAM1 Products

Bioinformatics Tool for CEECAM1 Antibody (NBP1-84551)

Discover related pathways, diseases and genes to CEECAM1 Antibody (NBP1-84551). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEECAM1 Antibody (NBP1-84551)

Discover more about diseases related to CEECAM1 Antibody (NBP1-84551).

Blogs on CEECAM1

There are no specific blogs for CEECAM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEECAM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CERCAM