GLT25D2 Antibody

Images

 
Western Blot: GLT25D2 Antibody [NBP1-90711] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: GLT25D2 Antibody [NBP1-90711] - Staining of human rectum shows strong granular positivity in glandular cells.
Western Blot: GLT25D2 Antibody [NBP1-90711] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLT25D2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PTHYTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQSRIYSNAKNTEALPPPTSLDTVPSRDEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLT25D2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GLT25D2 Protein (NBP1-90711PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLT25D2 Antibody

  • C1orf17
  • FLJ37771
  • FLJ37873
  • glycosyltransferase 25 domain containing 2
  • glycosyltransferase 25 family member 2
  • KIAA0584
  • procollagen galactosyltransferase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15857
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14619
Species: Hu
Applications: WB, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC

Publications for GLT25D2 Antibody (NBP1-90711) (0)

There are no publications for GLT25D2 Antibody (NBP1-90711).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLT25D2 Antibody (NBP1-90711) (0)

There are no reviews for GLT25D2 Antibody (NBP1-90711). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLT25D2 Antibody (NBP1-90711) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLT25D2 Products

Bioinformatics Tool for GLT25D2 Antibody (NBP1-90711)

Discover related pathways, diseases and genes to GLT25D2 Antibody (NBP1-90711). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLT25D2 Antibody (NBP1-90711)

Discover more about diseases related to GLT25D2 Antibody (NBP1-90711).
 

Pathways for GLT25D2 Antibody (NBP1-90711)

View related products by pathway.

PTMs for GLT25D2 Antibody (NBP1-90711)

Learn more about PTMs related to GLT25D2 Antibody (NBP1-90711).

Blogs on GLT25D2

There are no specific blogs for GLT25D2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLT25D2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLT25D2