Recombinant Human CEBP Beta Protein

Images

 
SDS-Page: Recombinant Human CEBP Beta Protein [H00001051-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CEBP Beta Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-345 of Human CEBPB full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CEBPB

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. Use in Gel Supper Shift Assays reported in scientific literature (PMID: 23051921) This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publications using H00001051-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CEBP Beta Protein

  • C/EBP beta
  • C/EBP-beta
  • CCAAT/enhancer binding protein (C/EBP), beta
  • CCAAT/enhancer-binding protein beta
  • CRP2
  • IL6DBP
  • interleukin 6-dependent DNA-binding protein
  • LAPTCF-5
  • Liver activator protein
  • liver-enriched transcriptional activator protein
  • MGC32080
  • NF-IL6
  • Nuclear factor NF-IL6
  • nuclear factor of interleukin 6
  • TCF5NFIL6
  • Transcription factor 5

Background

The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related proteins CEBP-alpha, CEBP-delta, and CEBP-gamma. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses and has been shown to bind to the IL-1 response element in the IL-6 gene, as well as to regulatory regions of several acute-phase and cytokine genes. In addition, the encoded protein can bind the promoter and upstream element and stimulate the expression of the collagen type I gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-85699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-42378
Species: Hu
Applications: WB, IHC
H00023049-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB110-85519
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB

Publications for CEBP Beta Recombinant Protein (H00001051-P01)(2)

Reviews for CEBP Beta Recombinant Protein (H00001051-P01) (0)

There are no reviews for CEBP Beta Recombinant Protein (H00001051-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CEBP Beta Recombinant Protein (H00001051-P01). (Showing 1 - 1 of 1 FAQs).

  1. I am interested in CEBP Beta Recombinant Protein (catalog# H00001051-P01) but I would like to have additional information. Could you please tell me in which organism it is produced, and whether it is glycosylated?
    • This product has been produced in an in vitro wheat germ expression system. It is not glycosylated.

Additional CEBP Beta Products

Bioinformatics Tool for CEBP Beta Recombinant Protein (H00001051-P01)

Discover related pathways, diseases and genes to CEBP Beta Recombinant Protein (H00001051-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEBP Beta Recombinant Protein (H00001051-P01)

Discover more about diseases related to CEBP Beta Recombinant Protein (H00001051-P01).
 

Pathways for CEBP Beta Recombinant Protein (H00001051-P01)

View related products by pathway.

PTMs for CEBP Beta Recombinant Protein (H00001051-P01)

Learn more about PTMs related to CEBP Beta Recombinant Protein (H00001051-P01).

Blogs on CEBP Beta.

Transcription Factor Antibodies Used In Landmark Evolutionary Study
We at Novus Biologicals offer a full antibody database targeted to transcription factor research. Recently, CEBP antibodieswere used in a research study exploring the evolution of gene regulation in various vertebrates. The results revealed surprising...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CEBP Beta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CEBPB