We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human CEBP Beta GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human CEBP Beta Protein [H00001051-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, GS, MA, AP

Order Details

Recombinant Human CEBP Beta GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-345 of Human CEBPB

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CEBPB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Gel Super Shift Assays
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Use in Gel Supper Shift Assays reported in scientific literature (PMID: 23051921)
Theoretical MW
62.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using H00001051-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CEBP Beta GST (N-Term) Protein

  • C/EBP beta
  • C/EBP-beta
  • CCAAT/enhancer binding protein (C/EBP), beta
  • CCAAT/enhancer-binding protein beta
  • CRP2
  • IL6DBP
  • interleukin 6-dependent DNA-binding protein
  • LAPTCF-5
  • Liver activator protein
  • liver-enriched transcriptional activator protein
  • MGC32080
  • NF-IL6
  • Nuclear factor NF-IL6
  • nuclear factor of interleukin 6
  • TCF5NFIL6
  • Transcription factor 5

Background

The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related proteins CEBP-alpha, CEBP-delta, and CEBP-gamma. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses and has been shown to bind to the IL-1 response element in the IL-6 gene, as well as to regulatory regions of several acute-phase and cytokine genes. In addition, the encoded protein can bind the promoter and upstream element and stimulate the expression of the collagen type I gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82847
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP1-85699
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00152503-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
7754-BH/CF
Species: Hu
Applications: BA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00023049-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NB110-85519
Species: Mu
Applications: ELISA, IHC, IP, KD, KO, WB
AF7094
Species: Hu
Applications: IHC
NBP1-89544
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
AF2214
Species: Hu
Applications: ICC, IHC, WB
NBP3-16602
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
H00001051-P01
Species: Hu
Applications: WB, ELISA, GS, MA, AP

Publications for CEBP Beta Recombinant Protein (H00001051-P01)(2)

Reviews for CEBP Beta Recombinant Protein (H00001051-P01) (0)

There are no reviews for CEBP Beta Recombinant Protein (H00001051-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CEBP Beta Recombinant Protein (H00001051-P01). (Showing 1 - 1 of 1 FAQs).

  1. I am interested in CEBP Beta Recombinant Protein (catalog# H00001051-P01) but I would like to have additional information. Could you please tell me in which organism it is produced, and whether it is glycosylated?
    • This product has been produced in an in vitro wheat germ expression system. It is not glycosylated.

Additional CEBP Beta Products

Research Areas for CEBP Beta Recombinant Protein (H00001051-P01)

Find related products by research area.

Blogs on CEBP Beta.

Transcription Factor Antibodies Used In Landmark Evolutionary Study
We at Novus Biologicals offer a full antibody database targeted to transcription factor research. Recently, CEBP antibodieswere used in a research study exploring the evolution of gene regulation in various vertebrates. The results revealed surprising...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CEBP Beta GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CEBPB