Recombinant Human CEBP Beta GST (N-Term) Protein

SDS-Page: Recombinant Human CEBP Beta Protein [H00001051-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, GS, MA, AP

Recombinant Human CEBP Beta GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-345 of Human CEBPB
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: CEBPB
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Gel Super Shift Assays
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Use in Gel Supper Shift Assays reported in scientific literature (PMID: 23051921)
• Theoretical MW: 62.5 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CEBP Beta GST (N-Term) Protein

• C/EBP beta
• C/EBP-beta
• CCAAT/enhancer binding protein (C/EBP), beta
• CCAAT/enhancer-binding protein beta
• CRP2
• IL6DBP
• interleukin 6-dependent DNA-binding protein
• LAPTCF-5
• Liver activator protein
• liver-enriched transcriptional activator protein
• MGC32080
• NF-IL6
• Nuclear factor NF-IL6
• nuclear factor of interleukin 6
• TCF5NFIL6
• Transcription factor 5

Background

The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related proteins CEBP-alpha, CEBP-delta, and CEBP-gamma. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses and has been shown to bind to the IL-1 response element in the IL-6 gene, as well as to regulatory regions of several acute-phase and cytokine genes. In addition, the encoded protein can bind the promoter and upstream element and stimulate the expression of the collagen type I gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for CEBP Beta Recombinant Protein (H00001051-P01)(2)

Publications using H00001051-P01

• Sasaki M, Hashimoto S, Sawa T, Amaya F. Tumor necrosis factor-alpha induces expression of C/EBP-beta in primary afferent neurons following nerve injury. Neuroscience. 2014-08-27 [PMID: 25173154]
• Venza I, Visalli M, Fortunato C et al. PGE2 induces interleukin-8 derepression in human astrocytoma through coordinated DNA demethylation and histone hyperacetylation. Epigenetics 2012-11-01 [PMID: 23051921] (GS)

FAQs for CEBP Beta Recombinant Protein (H00001051-P01). (Showing 1 - 1 of 1 FAQs).

1. I am interested in CEBP Beta Recombinant Protein (catalog# H00001051-P01) but I would like to have additional information. Could you please tell me in which organism it is produced, and whether it is glycosylated?
   • This product has been produced in an in vitro wheat germ expression system. It is not glycosylated.

Bioinformatics

• Gene Symbol: CEBPB