Recombinant Human CEBP Beta Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CEBP Beta Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-89 of Human CEBPB partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CEBPB

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CEBP Beta Protein

  • C/EBP beta
  • C/EBP-beta
  • CCAAT/enhancer binding protein (C/EBP), beta
  • CCAAT/enhancer-binding protein beta
  • CRP2
  • IL6DBP
  • interleukin 6-dependent DNA-binding protein
  • LAPTCF-5
  • Liver activator protein
  • liver-enriched transcriptional activator protein
  • MGC32080
  • NF-IL6
  • Nuclear factor NF-IL6
  • nuclear factor of interleukin 6
  • TCF5NFIL6
  • Transcription factor 5

Background

CEBPB - CCAAT/enhancer binding protein (C/EBP), beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-85699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-42378
Species: Hu
Applications: WB, IHC
H00023049-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB110-85519
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB

Publications for CEBP Beta Partial Recombinant Protein (H00001051-Q01) (0)

There are no publications for CEBP Beta Partial Recombinant Protein (H00001051-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEBP Beta Partial Recombinant Protein (H00001051-Q01) (0)

There are no reviews for CEBP Beta Partial Recombinant Protein (H00001051-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CEBP Beta Partial Recombinant Protein (H00001051-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CEBP Beta Products

Bioinformatics Tool for CEBP Beta Partial Recombinant Protein (H00001051-Q01)

Discover related pathways, diseases and genes to CEBP Beta Partial Recombinant Protein (H00001051-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEBP Beta Partial Recombinant Protein (H00001051-Q01)

Discover more about diseases related to CEBP Beta Partial Recombinant Protein (H00001051-Q01).
 

Pathways for CEBP Beta Partial Recombinant Protein (H00001051-Q01)

View related products by pathway.

PTMs for CEBP Beta Partial Recombinant Protein (H00001051-Q01)

Learn more about PTMs related to CEBP Beta Partial Recombinant Protein (H00001051-Q01).

Blogs on CEBP Beta.

Transcription Factor Antibodies Used In Landmark Evolutionary Study
We at Novus Biologicals offer a full antibody database targeted to transcription factor research. Recently, CEBP antibodieswere used in a research study exploring the evolution of gene regulation in various vertebrates. The results revealed surprising...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CEBP Beta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CEBPB