CEBP Beta Antibody [DyLight 594] Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 171-216 of human CEBP Beta (NP_005185.2).
Sequence: AELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CEBPB |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.
Alternate Names for CEBP Beta Antibody [DyLight 594]
Background
CCAAT/enhancer-binding proteins (C/EBP) consist of a family of transcription factors that play an important role in regulating the balance between cell growth and differentiation. The various isoforms of C/EBP (alpha, beta, gamma, delta, epsilon, zeta) exhibit similar DNA-binding specificities and contain a leucine zipper dimerization domain (1). A number of serine targets of PKA have been identified in C/EBP, suggesting its activities are post-translationally regulated by cAMP (2). Even though, it has been show that C/EBP beta occurs predominantly as a heterodimer (3). C/EBP beta gamma readily heterodimerize with each other as well as with C/EBP alpha (4). Additionally, 3 isoforms of C/EBP beta can be detected (LAP, LAP,LIP)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC, Simple Western, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Mu
Applications: ELISA, IHC, IP, KD, KO, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
Publications for CEBP Beta Antibody (NBP3-35083DL594) (0)
There are no publications for CEBP Beta Antibody (NBP3-35083DL594).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CEBP Beta Antibody (NBP3-35083DL594) (0)
There are no reviews for CEBP Beta Antibody (NBP3-35083DL594).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CEBP Beta Antibody (NBP3-35083DL594) (0)