| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | CEBPB (AAH21931.1, 1 a.a. - 345 a.a.) full-length human protein. MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC |
| Specificity | CEBPB - CCAAT/enhancer binding protein (C/EBP), beta, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | CEBPB |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CEBP Beta Antibody (H00001051-B01P)Find related products by research area.
|
|
Transcription Factor Antibodies Used In Landmark Evolutionary Study We at Novus Biologicals offer a full antibody database targeted to transcription factor research. Recently, CEBP antibodieswere used in a research study exploring the evolution of gene regulation in various vertebrates. The results revealed surprising... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CEBPB |
| Entrez |
|
| Uniprot |
|