CEACAM6/CD66c Antibody (4Z3V7) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CEACAM6/CD66c (P40199). LTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQ |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
CEACAM6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:1000
|
| Theoretical MW |
37 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CEACAM6/CD66c Antibody (4Z3V7)
Background
CEA-related cell adhesion molecules (CEACAM) belong to the carcinoembryonic antigen (CEA) family. It consists of seven CEACAM (CEACAM 1, CEACAM 3-CEACAM 8) and 11 pregnancy-specific glycoprotein (PSG1-PSG11) members. The CEA family proteins belong to the immunoglobulin (Ig) superfamily and are composed of one Ig variable like (IgV) and a varying number (0-6) of Ig constant-like (IgC) domains. CEACAM molecules are membrane-bound either via a transmembrane domain or a glycosyl phosphatidyl inositol (GPI) anchor. CEACAM molecules are differentially expressed in epithelial cells or in leucocytes. Over-expression of CEA/CEACAM 5 in tumors of epithelial origin is the basis of its wide-spread use as a tumor marker. CEACAM 6 expression is strongly up-regulated already during early stages of adenocarcinoma formation e.g. in colon. The function of CEA family members varies widely: they function as cell adhesion molecules, tumor suppressors, regulators of lymphocyte and dendritic cell activation, receptors of Neisseria species and other bacteria.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu
Applications: IHC, Simple Western, WB
Publications for CEACAM6/CD66c Antibody (NBP3-16625) (0)
There are no publications for CEACAM6/CD66c Antibody (NBP3-16625).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CEACAM6/CD66c Antibody (NBP3-16625) (0)
There are no reviews for CEACAM6/CD66c Antibody (NBP3-16625).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CEACAM6/CD66c Antibody (NBP3-16625) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CEACAM6/CD66c Products
Research Areas for CEACAM6/CD66c Antibody (NBP3-16625)
Find related products by research area.
|
Blogs on CEACAM6/CD66c