CDYL Antibody - BSA Free

Western Blot: CDYL Antibody [NBP1-52986] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Immunocytochemistry/Immunofluorescence: CDYL Antibody [NBP1-52986] - Sample Type: MD MB231, Primary Antibody Dilution: 4 ug/ml

Immunocytochemistry/Immunofluorescence: CDYL Antibody [NBP1-52986] - Sample Type: HeLa, Primary Antibody Dilution: 4 ug/ml

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CDYL Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CDYL(chromodomain protein, Y-like) The peptide sequence was selected from the n terminal of CDYL. Peptide sequence YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDYL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CDYL Antibody - BSA Free

• CDYL1bA620A17.2 (chromodomain protein, Y chromosome-like)
• CDY-like
• CDY-like, autosomal
• chromodomain protein, Y chromosome-like
• chromodomain protein, Y-like
• chromodomain Y-like protein
• DKFZP586C1622
• EC 2.3.1.48
• MGC131936
• testis-specific chromodomain Y-like protein

Background

CDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDYL
• Uniprot:
  • Q9Y232(Human)