CDYL Antibody

Images

 
Western Blot: CDYL Antibody [NBP1-52986] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.
Immunocytochemistry/ Immunofluorescence: CDYL Antibody [NBP1-52986] - Sample Type: MD MB231, Primary Antibody Dilution: 4 ug/ml
Immunocytochemistry/ Immunofluorescence: CDYL Antibody [NBP1-52986] - Sample Type: HeLa, Primary Antibody Dilution: 4 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDYL Antibody Summary

Immunogen
Synthetic peptides corresponding to CDYL(chromodomain protein, Y-like) The peptide sequence was selected from the n terminal of CDYL. Peptide sequence YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDYL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
Application Notes
This is a rabbit polyclonal antibody against CDYL and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CDYL Antibody

  • CDYL1bA620A17.2 (chromodomain protein, Y chromosome-like)
  • CDY-like
  • CDY-like, autosomal
  • chromodomain protein, Y chromosome-like
  • chromodomain protein, Y-like
  • chromodomain Y-like protein
  • DKFZP586C1622
  • EC 2.3.1.48
  • MGC131936
  • testis-specific chromodomain Y-like protein

Background

CDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009426-Q01
Species: Hu
NBP2-13948
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83470
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
MAB6047
Species: Hu
Applications: WB, ICC
NBP1-80586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-757
Species: Hu
Applications: WB, IHC, IHC-P
NB100-61070
Species: Hu
Applications: WB (-), IP
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008294-P01
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
H00008363-P01
Species: Hu
H00008362-P01
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF

Publications for CDYL Antibody (NBP1-52986) (0)

There are no publications for CDYL Antibody (NBP1-52986).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDYL Antibody (NBP1-52986) (0)

There are no reviews for CDYL Antibody (NBP1-52986). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDYL Antibody (NBP1-52986) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CDYL Antibody (NBP1-52986)

Discover related pathways, diseases and genes to CDYL Antibody (NBP1-52986). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDYL Antibody (NBP1-52986)

Discover more about diseases related to CDYL Antibody (NBP1-52986).
 

Pathways for CDYL Antibody (NBP1-52986)

View related products by pathway.

PTMs for CDYL Antibody (NBP1-52986)

Learn more about PTMs related to CDYL Antibody (NBP1-52986).

Blogs on CDYL

There are no specific blogs for CDYL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDYL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDYL
Uniprot