CDX4 Antibody (2H7)


Western Blot: CDX4 Antibody (2H7) [H00001046-M11] - Analysis of CDX4 expression in Hela S3 NE (Cat # L013V3).
Western Blot: CDX4 Antibody (2H7) [H00001046-M11] - Analysis of CDX4 expression in PC-12 (Cat # L012V1).
Western Blot: CDX4 Antibody (2H7) [H00001046-M11] - Analysis of CDX4 expression in Raw 264.7 (Cat # L024V1).

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA

Order Details

CDX4 Antibody (2H7) Summary

CDX4 (NP_005184 202 a.a. - 284 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE*
CDX4 (2H7)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDX4 Antibody (2H7)

  • caudal type homeo box transcription factor 4
  • caudal type homeobox 4
  • caudal type homeobox transcription factor 4
  • Caudal-type homeobox protein 4
  • CDX4
  • homeobox protein CDX-4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, ICC

Publications for CDX4 Antibody (H00001046-M11) (0)

There are no publications for CDX4 Antibody (H00001046-M11).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDX4 Antibody (H00001046-M11) (0)

There are no reviews for CDX4 Antibody (H00001046-M11). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDX4 Antibody (H00001046-M11) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CDX4 Products

Bioinformatics Tool for CDX4 Antibody (H00001046-M11)

Discover related pathways, diseases and genes to CDX4 Antibody (H00001046-M11). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDX4 Antibody (H00001046-M11)

Discover more about diseases related to CDX4 Antibody (H00001046-M11).

Pathways for CDX4 Antibody (H00001046-M11)

View related products by pathway.

PTMs for CDX4 Antibody (H00001046-M11)

Learn more about PTMs related to CDX4 Antibody (H00001046-M11).

Blogs on CDX4

There are no specific blogs for CDX4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CDX4 Antibody (2H7) and receive a gift card or discount.


Gene Symbol CDX4