CDX4 Antibody (1E11) - Azide and BSA Free

Western Blot: CDX4 Antibody (1E11) [H00001046-M16] - Analysis of CDX4 expression in NIH/3T3 (Cat # L018V1).

Western Blot: CDX4 Antibody (1E11) [H00001046-M16] - Analysis of CDX4 expression in HepG2 (Cat # L019V1).

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 1E11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CDX4 Antibody (1E11) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CDX4 (NP_005184, 202 a.a. ~ 284 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE*
• Specificity: CDX4 (1E11)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CDX4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDX4 Antibody (1E11) - Azide and BSA Free

• caudal type homeo box transcription factor 4
• caudal type homeobox 4
• caudal type homeobox transcription factor 4
• Caudal-type homeobox protein 4
• CDX4
• homeobox protein CDX-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDX4
• Entrez:
  • 1046(Human)
• OMIM:
  • 300025(Human)
• Uniprot:
  • NP_005184(Human)