CDV3 Antibody

Images

 
Western Blot: CDV3 Antibody [NBP2-87167] - Host: Rabbit. Target Name: CDV3. Sample Type: Placenta lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDV3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDV3. Peptide sequence: DGGTASAGAAGPGAATKAVTKDEDEWKELEQKEVDYSGLRVQAMQISSEK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CDV3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDV3 Antibody

  • CDV3 homolog (mouse)
  • H41carnitine deficiency-associated gene expressed in ventricle 3
  • protein CDV3 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1129-ER
Species: Hu
Applications: BA
NBP1-83594
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02860
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-88988
Species: Hu
Applications: ICC/IF, KD, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP1-88579
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3025
Species: Hu
Applications: ELISA, ICC, WB
1596-B1
Species: Rt
Applications: Bind
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB6860
Species: Hu
Applications: IP, WB
NB100-217
Species: Hu, Mu
Applications: IP, WB
H00008294-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NB21-2024
Species: Hu, Ma, Mu, Po, Rt
Applications: ChIP, DB, ICC/IF, WB
NBP2-87167
Species: Hu
Applications: WB

Publications for CDV3 Antibody (NBP2-87167) (0)

There are no publications for CDV3 Antibody (NBP2-87167).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDV3 Antibody (NBP2-87167) (0)

There are no reviews for CDV3 Antibody (NBP2-87167). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDV3 Antibody (NBP2-87167) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDV3 Products

Bioinformatics Tool for CDV3 Antibody (NBP2-87167)

Discover related pathways, diseases and genes to CDV3 Antibody (NBP2-87167). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDV3 Antibody (NBP2-87167)

Discover more about diseases related to CDV3 Antibody (NBP2-87167).
 

Pathways for CDV3 Antibody (NBP2-87167)

View related products by pathway.

PTMs for CDV3 Antibody (NBP2-87167)

Learn more about PTMs related to CDV3 Antibody (NBP2-87167).

Blogs on CDV3

There are no specific blogs for CDV3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDV3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDV3